13th Community Wide Experiment on the
Critical Assessment of Techniques for Protein Structure Prediction
Target List csv
 
Targets expire on the specified date at noon (12:00) local time in California (GMT - 7 hours).

Green color - active target; Yellow color - target expires within 48 hours; Orange color - target expires within 24 hours; Red color - target has expired for server TS/RR predictions, but is still open for QA predictions. Refinement and data-assisted targets are highlighted with the light grey background.

* targets selected for CAPRI experiment
All targets Regular Heteromers Refinement Assisted structure prediction
All groups | Server only SAXS | X-link | NMR | SANS | FRET
#
Tar-id
Type
Res
Stoi-
chiom.
Entry
Date
Server
Expiration
QA
Expiration
Human
Expiration
Description
1. n1008 Assisted - A1 2018-09-18 2018-09-21 - 2018-09-30 This is REAL NMR data -assisted target corresponding to T1008. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes experimental data for dihedrals, ambiguous distance restraints, and the sequence. With respect to earlier suggested target N1008 (starting from capital 'N'), now both backbone AND extensive sidechain resonance assignments were used to generate the Ambiguous Contact file, so the false positive rate is very low. There is also a README explaining the data.

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

2. R0996-D7 Refinement - - 2018-08-10 2018-08-13 - 2018-08-25 This refinement target corresponds to domain 7 (res. 709-848) of T0996. Starting model's GDT_HA=55 (calculated on residues belonging to the domain).  
3. R0996-D5 Refinement - - 2018-08-10 2018-08-13 - 2018-08-25 This refinement target corresponds to domain 5 (res. 484-604) of T0996. Starting model's GDT_HA=56 (calculated on residues belonging to the domain).  
4. R0996-D4 Refinement - - 2018-08-10 2018-08-13 - 2018-08-25 This refinement target corresponds to domain 4 (res. 351-483) of T0996. Starting model's GDT_HA=53 (calculated on residues belonging to the domain).  
5. N1008 Assisted - A1 2018-08-10 2018-08-13 - 2018-09-10 This is REAL NMR data -assisted target corresponding to T1008. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes four files: 1. ambiguous restraints; 2. dihedral angle restraints; 3. sequence file; 4. a README describing the sample and the nature of the restraints.

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

6. N1005 Assisted - A1 2018-08-10 2018-08-13 - 2018-08-25 This is simulated NMR data-assisted target corresponding to T1005. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

7. N0980 Assisted - A1B1 2018-08-10 2018-08-13 - 2018-08-26 This is an NMR-simulated data-assisted target representing the heterodimer target H0980. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

8. F0964 Assisted - A1 2018-08-10 2018-08-13 - 2018-09-30 This is a FRET data-assisted modeling target.
This data type is new in CASP. Results will not be competitively assessed in CASP13. Rather, with this target we are initiating a discussion and allowing for a learning experience with the development of future FRET-based modeling techniques in mind. We are providing ample time to model this target with the closing date of September 30 (pending approval from the structure's author).
The molecule’s two domains seem open to homology modeling but the relative domain orientation is not known (we have the structure of only the second of the two domains starting with the residues VIVIGDE). The FRET data suggest that there may be a distribution of domain orientations, opening a challenge of dynamic modeling in CASP. This topic will be discussed at the CASP13 meeting.

The description of the FRET data and an overview of the results for this particular target can be found at http://predictioncenter.org/casp13/doc/FRET_CASP13_AGSeidel.pdf .
The detailed FRET data will be released progressively as they become available.  

9. R1016 Refinement - - 2018-08-09 2018-08-12 - 2018-08-24 This refinement target corresponds to T1016. Starting model's GDT_HA=63.  
10. R0993s2 Refinement - - 2018-08-09 2018-08-12 - 2018-08-24 This refinement target corresponds to second subunit of H0993 complex. Starting model's GDT_HA=51. The His-tag was not observed in density, so that the chain should start with residue 12.  
11. N0981-D5 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 5 (res. 514-640) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

12. N0981-D4 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 4 (res. 403-513) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

13. N0981-D3 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 3 (res. 191-393) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

14. N0981-D2 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 2 (res. 120-190, 394-402) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

15. N0981-D1 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 1 (res. 34-119) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

16. R0976-D2 Refinement - - 2018-08-08 2018-08-11 - 2018-08-24 This refinement target corresponds to domain 2 (res. 129-252) of T0976. Starting model's GDT_HA=65 (calculated on residues belonging to the domain).  
17. R0976-D1 Refinement - - 2018-08-08 2018-08-11 - 2018-08-24 This refinement target corresponds to domain 1 (res. 9-128) of T0976. Starting model's GDT_HA=69 (calculated on residues belonging to the domain).  
18. x0987 Assisted - A1 2018-08-07 2018-08-10 - 2018-08-22 This is a cross-linking assisted modeling target. The experimental data were acquired by J.Rappsilber's group and posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0987_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target, please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

19. R1009-D3 Refinement - - 2018-08-07 2018-08-10
canceled on
2018-08-21
- 2018-08-23
canceled on
2018-08-21
This refinement target corresponds to domain 3 (res. 595-718) of T1009. The target is a glycoprotein. Starting model's GDT_HA=63 (calculated on residues belonging to the domain). Canceled: structure 6dru appeared in the PDB on Aug 21.  
20. R0982-D2 Refinement - - 2018-08-07 2018-08-10 - 2018-08-23 This refinement target corresponds to domain 2 (res. 146-277) of T0982. Starting model's GDT_HA=50 (calculated on residues belonging to the domain).  
21. N0980s1 Assisted - A1 2018-08-07 2018-08-10 - 2018-08-22 This is an NMR-simulated data-assisted target representing the first subunit of H0980 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

22. x0975 Assisted - A1 2018-08-06 2018-08-09 - 2018-08-20 This is a cross-linking assisted modeling target. The experimental data were acquired by J.Rappsilber's group and posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0975_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target, please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

23. R1004-D2 Refinement - - 2018-08-03 2018-08-06 - 2018-08-19 This refinement target corresponds to domain 2 (res. 152-228) of T1004. Starting model's GDT_HA=60 (calculated on residues belonging to the domain).  
24. N0968s2 Assisted - A1 2018-08-03 2018-08-06 - 2018-08-19 This is an NMR-simulated data-assisted target representing the second subunit of H0968 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

25. N0968s1 Assisted - A1 2018-08-03 2018-08-06 - 2018-08-19 This is an NMR-simulated data-assisted target representing the first subunit of H0968 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

26. X0999 * Assisted - A2 2018-08-01 2018-08-04 - 2018-08-20 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Raw XL-MS data for this target are currently unavailable.  

27. N0989 Assisted - A1 2018-07-31 2018-08-03 - 2018-08-18 This is an NMR-simulated data-assisted target corresponding to regular target T0989. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts); _dihed.txt (NMR-derived ranges for phi and psi); _ECs.txt (Evolutionary constraints); _RDCs.txt (NMR-derived residual dipolar couplings); _seq.txt (protein/domain sequence).

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

28. N0957s1 Assisted - A1 2018-07-26 2018-07-29 - 2018-08-17 This is an NMR-simulated data-assisted target representing the first subunit of the H0957 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts); _dihed.txt (NMR-derived ranges for phi and psi); _ECs.txt (Evolutionary constraints); _RDCs.txt (NMR-derived residual dipolar couplings); _seq.txt (protein/domain sequence).

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

29. R1001 Refinement - - 2018-07-24 2018-07-27 - 2018-08-14 Starting model's GDT_HA=53. Residue 1 is absent from the target and deleted from the starting model.  
30. X0987 Assisted - A1 2018-07-23 2018-07-26 - 2018-08-07 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010410
and use the following credentials to login:
Username: reviewer33138@ebi.ac.uk
Password: 0bvme2ld

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

31. R1002-D2 Refinement - - 2018-07-23 2018-07-26 - 2018-08-13 This refinement target corresponds to domain 2 (res. 60-118) of T1002. Starting model's GDT_HA=66 (calculated on residues belonging to the domain).  
32. R0999-D3 Refinement - - 2018-07-20 2018-07-23 - 2018-08-10 This refinement target corresponds to domain 3 (res. 866-1045) of T0999. Starting model's GDT_HA=54 (calculated on residues belonging to the domain). The original target is a homodimer.  
33. N0953s2 Assisted - A1 2018-07-20 2018-07-23 - 2018-08-16
canceled on
2018-08-02
This is an NMR-simulated data-assisted target representing the second subunit of the H0953 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Each zip includes five (tab-delimited) text files. E.g. T0953s2_ambiR.txt (NMR-derived ambiguous contacts) T0953s2_dihed.txt (NMR-derived ranges for phi and psi) T0953s2_ECs.txt (Evolutionary constraints) T0953s2_RDCs.txt (NMR-derived residual dipolar couplings) T0953s2_seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf  

34. X0985 Assisted - A1 2018-07-19 2018-07-22 - 2018-08-08 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010483
and use the following credentials to login:
Username: reviewer80816@ebi.ac.uk
Password: 4Z1QRYaH

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

35. R0979 Refinement - - 2018-07-19 2018-07-22 - 2018-08-09 This is the first oligomeric refinement target in CASP. Being a trimer, it is somewhat longer than other refinement targets in CASP13: 276 residues total. GDT_HA of the starting model's monomeric unit is 55 (on 92 residues; residues 1-5 and 98 are absent from the experimental structure). LDDT score of the oligomeric starting model is 0.81; the inter-chain contact accuracy score F1=43%. All rules pertaining to submission of regular homo-oligomeric targets apply here.  
36. R0997 Refinement - - 2018-07-18 2018-07-21 - 2018-08-08 Starting model's GDT_HA=42 (on residues 44-228). Residues 1-43 are deleted from the starting model.  
37. X0981 Assisted - A3 2018-07-17 2018-07-20 - 2018-08-07 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010384
and use the following credentials to login:
Username: reviewer66164@ebi.ac.uk
Password: S5U0kqOw

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

38. T1023s3 All groups 472 A1 2018-07-17 2018-07-20
canceled on
2018-09-17
m1: 2018-07-24
m2: 2018-07-26
2018-08-06
canceled on
2018-09-17
eIF2
Canceled: no structure.
39. T1023s2 All groups 333 A1 2018-07-17 2018-07-20
canceled on
2018-09-17
m1: 2018-07-24
m2: 2018-07-26
2018-08-06
canceled on
2018-09-17
eIF2
Canceled: no structure.
40. T1023s1 All groups 315 A1 2018-07-17 2018-07-20
canceled on
2018-09-17
m1: 2018-07-24
m2: 2018-07-26
2018-08-06
canceled on
2018-09-17
eIF2
Canceled: no structure.
41. H1023 All groups 1120 A1B1C1 2018-07-17 2018-07-20
canceled on
2018-09-17
- 2018-08-06
canceled on
2018-09-17
eIF2
Canceled: no structure.
42. X0975 Assisted - A1 2018-07-16 2018-07-19 - 2018-08-06 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010385
and use the following credentials to login:
Username: reviewer81343@ebi.ac.uk
Password: zK0BY71P

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

43. x0968s2 Assisted - A1 2018-07-16 2018-07-19 - 2018-08-02 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

44. x0968s1 Assisted - A1 2018-07-16 2018-07-19 - 2018-08-02 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

45. x0968 Assisted - A2B2 2018-07-16 2018-07-19 - 2018-08-02 This is a cross-linking assisted modeling target. The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

46. T1022s2 All groups 529 A1 2018-07-16 2018-07-19 m1: 2018-07-23
m2: 2018-07-25
2018-08-05 Q6HAD2,Q6HAD1
PDB code 6rbk
47. T1022s1 All groups 229 A1 2018-07-16 2018-07-19 m1: 2018-07-23
m2: 2018-07-25
2018-08-05 Q6HAD2,Q6HAD1
PDB code 6rbk
48. H1022 All groups 758 A6B3 2018-07-16 2018-07-19 - 2018-08-05 Q6HAD2,Q6HAD1
PDB code 6rbk
49. T1021s3 All groups 295 A1 2018-07-13 2018-07-16 m1: 2018-07-20
m2: 2018-07-22
2018-08-03 Q6HAD8,Q6HAD7,Q6HAC3
PDB code 6rap
50. T1021s2 All groups 354 A1 2018-07-13 2018-07-16 m1: 2018-07-20
m2: 2018-07-22
2018-08-03 Q6HAD8,Q6HAD7,Q6HAC3
PDB code 6rap
51. T1021s1 All groups 149 A1 2018-07-13 2018-07-16 m1: 2018-07-20
m2: 2018-07-22
2018-08-03 Q6HAD8,Q6HAD7,Q6HAC3
PDB code 6rap
52. S0999 * Assisted - A2 2018-07-13 2018-07-16 - 2018-07-31 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
53. R0989-D1 Refinement - - 2018-07-13 2018-07-16 - 2018-08-03 This refinement target corresponds to domain 1 (res. 1-134) of T0989. Starting model's GDT_HA=34 (calculated on residues belonging to the domain). Please remember that the original target is a homotrimer. There is a lot of room for improvement, especially in the N-terminus.  
54. H1021 * All groups 798 A6B6C6 2018-07-13 2018-07-16 - 2018-08-03 Q6HAD8,Q6HAD7,Q6HAC3
PDB code 6rap
55. T1020 * All groups 577 A3 2018-07-12 2018-07-15 m1: 2018-07-19
m2: 2018-07-21
2018-07-31 SLAC1
PDB code 7en0
56. T1019s2 All groups 88 A1 2018-07-12 2018-07-15 m1: 2018-07-19
m2: 2018-07-21
2018-07-31 CDI207t
57. T1019s1 All groups 58 A1 2018-07-12 2018-07-15 m1: 2018-07-19
m2: 2018-07-21
2018-07-31 CDI207t
58. H1019 * All groups 146 A1B1 2018-07-12 2018-07-15 - 2018-07-31 CDI207t
59. T1018 All groups 334 A2 2018-07-11 2018-07-14 m1: 2018-07-18
m2: 2018-07-20
2018-08-01 IDP04388
PDB code 6n91
60. T1017s2 All groups 129 A1 2018-07-11 2018-07-14 m1: 2018-07-18
m2: 2018-07-20
2018-08-01 201_INDD4
61. T1017s1 All groups 111 A1 2018-07-11 2018-07-14 m1: 2018-07-18
m2: 2018-07-20
2018-08-01 201_INDD4
62. R0992 Refinement - - 2018-07-11 2018-07-14 - 2018-08-01 Starting model's GDT_HA=65. Residues 1-3, 111-126 are absent from the target and deleted from the starting model.  
63. H1017 * All groups 240 A1B1 2018-07-11 2018-07-14 - 2018-08-01 201_INDD4
64. T1016 All groups 203 A2 2018-07-10 2018-07-13 m1: 2018-07-17
m2: 2018-07-19
2018-08-01 IDP96117
PDB code 6e4b
65. T1015s2 All groups 129 A1 2018-07-10 2018-07-13 m1: 2018-07-17
m2: 2018-07-19
2018-08-01 CDI_213
66. T1015s1 All groups 89 A1 2018-07-10 2018-07-13 m1: 2018-07-17
m2: 2018-07-19
2018-08-01 CDI_213
67. H1015 * All groups 218 A1B1 2018-07-10 2018-07-13 - 2018-08-01 CDI_213
68. T1014 All groups 276 A1 2018-07-09 2018-07-12 m1: 2018-07-16
m2: 2018-07-18
2018-08-01 WP_010918027.1
PDB code 6qrj
69. T1013 All groups 537 A1 2018-07-09 2018-07-12 m1: 2018-07-16
m2: 2018-07-18
2018-08-01 UNK2
70. R0986s2 Refinement - - 2018-07-09 2018-07-12 - 2018-08-01 Starting model's GDT_HA=49.  
71. R0986s1 Refinement - - 2018-07-09 2018-07-12 - 2018-08-01 Starting model's GDT_HA=59. Residues 1-4 are absent from the target structure and deleted from the starting model.  
72. T1012 All groups 199 A1 2018-07-06 2018-07-09
canceled on
2018-09-13
m1: 2018-07-13
m2: 2018-07-15
2018-08-01
canceled on
2018-09-13
Puromycin N-acetyltransferase
Canceled: no structure.
73. T1011 All groups 534 A1 2018-07-06 2018-07-09 m1: 2018-07-13
m2: 2018-07-15
2018-08-01 UNK1
PDB code 6m9t
74. S0992 Assisted - A1 2018-07-06 2018-07-09 - 2018-07-22 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
75. R0977-D2 Refinement - - 2018-07-06 2018-07-09 - 2018-08-01 This refinement target corresponds to domain 2 (res. 360-563) of T0977. Starting model's GDT_HA=68 (calculated on residues belonging to the domain). Please remember that the original target is a homotrimer. The interface in the starting model is modeled reasonably accurate.  
76. x0957s2 Assisted - A1 2018-07-05 2018-07-08 - 2018-07-25 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

77. x0957s1 Assisted - A1 2018-07-05 2018-07-08 - 2018-07-25 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

78. x0957 Assisted - A1B1 2018-07-05 2018-07-08 - 2018-07-25 This is a cross-linking assisted modeling target. The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

79. T1010 All groups 210 A2 2018-07-05 2018-07-08 m1: 2018-07-12
m2: 2018-07-14
2018-07-26 B2BM43
PDB code 6ubl
80. S0987 Assisted - A1 2018-07-05 2018-07-08 - 2018-07-22 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
81. R0981-D3 Refinement - - 2018-07-05 2018-07-08 - 2018-07-26 This refinement target corresponds to domain 3 (res. 191-393) of T0981. Starting model's GDT_HA=32 (calculated on residues belonging to the domain). Please remember that the original target is a homotrimer. The interface in the starting model is modeled reasonably accurate.  
82. T1009 * All groups 718 A2 2018-07-03 2018-07-06 m1: 2018-07-10
m2: 2018-07-12
2018-07-24 A2QTU5.1
PDB code 6dru
83. T1008 All groups 80 A1 2018-07-03 2018-07-06 m1: 2018-07-10
m2: 2018-07-12
2018-07-24 UW_engnr
PDB code 6msp
84. R0981-D5 Refinement - - 2018-07-03 2018-07-06 - 2018-07-24 This refinement target corresponds to domain 5 (res. 514-640) of T0981. Starting model's GDT_HA=42 (calculated on residues belonging to the domain). Please remember that the original target is a homotrimer. Residues 605-623 are a part of a homotrimer interface and modeling of this segment can be improved the most.  
85. R0981-D4 Refinement - - 2018-07-03 2018-07-06 - 2018-07-24 This refinement target corresponds to domain 4 (res. 403-513) of T0981. Starting model's GDT_HA=45 (calculated on residues belonging to the domain). Please remember that the original target is a homotrimer. The interface in the starting model is modeled reasonably accurate.  
86. T1007 All groups 149 A1 2018-07-02 2018-07-05
canceled on
2018-09-13
m1: 2018-07-09
m2: 2018-07-11
2018-07-23
canceled on
2018-09-13
Proline-rich acidic protein 1
Canceled: no structure.
87. T1006 * All groups 79 A2 2018-07-02 2018-07-05 m1: 2018-07-09
m2: 2018-07-11
2018-07-23 >MamM magnetosome protein
PDB code 6qek
88. A0953s2 Assisted - A1 2018-07-02 2018-07-05 - 2018-07-23  
89. A0953s1 Assisted - A1 2018-07-02 2018-07-05 - 2018-07-23  
90. A0953 Assisted - A3B1 2018-07-02 2018-07-05 - 2018-07-23 This is a SANS-assisted target for the H0953 heteromer. With this target we want to explore (in a non-competitive mode) the added value of small-angle neutron scattering data for structure prediction.

The data were collected on the full heteromeric complex. They are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/A0953_SANS*

The description of the data can be found at http://predictioncenter.org/casp13/doc/SANS-SG_AM_tutorial.pdf  

91. T1005 All groups 364 A1 2018-06-29 2018-07-02 m1: 2018-07-06
m2: 2018-07-08
2018-07-20 BT1044
PDB code 6q64
92. S0985 Assisted - A1 2018-06-29 2018-07-02 - 2018-07-18 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
93. T1004 All groups 458 A3 2018-06-28 2018-07-01 m1: 2018-07-05
m2: 2018-07-07
2018-07-19 YP_009041344.1
94. T1003 * All groups 474 A2 2018-06-27 2018-06-30 m1: 2018-07-04
m2: 2018-07-06
2018-07-17 ALAS2
PDB code 6hrh
95. X0968s2 Assisted - A1 2018-06-26 2018-06-29 - 2018-07-15 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer91348@ebi.ac.uk
Password: q9fEUNmI

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

96. X0968s1 Assisted - A1 2018-06-26 2018-06-29 - 2018-07-15 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer91348@ebi.ac.uk
Password: q9fEUNmI

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

97. X0968 Assisted - A2B2 2018-06-26 2018-06-29 - 2018-07-15 This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer91348@ebi.ac.uk
Password: q9fEUNmI

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

98. T1002 All groups 270 A1 2018-06-26 2018-06-29 m1: 2018-07-03
m2: 2018-07-05
2018-07-17 Q184J8
99. T1001 All groups 140 A2 2018-06-26 2018-06-29 m1: 2018-07-03
m2: 2018-07-05
2018-07-17 Q6MIM9
100. S0981 Assisted - A3 2018-06-26 2018-06-29 - 2018-07-15 This is a SAXS-assisted target. Experimental results are generated on the expressed protein with a tag (not provided in the released CASP sequence). The residues not included in the CASP target are encompassed in brackets in the full sequence below: [MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGS] MAFNYTPLTETQKLKDMYPKVNDIGN FLKTEVNLSDVKQISQPDFNNILASIPDSGNYYVTNSKGAPSGEATAGFVRLDKRNVNYY KIYYSPYSSNKMYIKTYANGTVYDWISFKLDEGSLYNEGNTLNVKELTESTTQYATLVNP PKENLNTGWVNYKESKNGVSSLVEFNPVNSTSTFKMIRKLPVQEQKPNLLKDSLFVYPET SYSNIKTDNWDTPPFWGYSSNSGRSGVRFRGENTVQIDDGSDTYPSVVSNRFKMGKELSV GDTVTVSVYAKINDPALLKDNLVYFELAGYDTVDDTSKNPYTGGRREITASEITTEWKKY SFTFTIPENTIGASGVKVNYVSLLLRMNCSSSKGNGAVVYYALPKLEKSSKVTPFITHEN DVRKYDEIWSNWQEVISKDELKGHSPVDIEYNDYFKYQWWKSEVNEKSLKDLAMTVPQGY HTFYCQGSIAGTPKGRSIRGTIQVDYDKGDPYRANKFVKLLFTDTEGIPYTLYYGGYNQG WKPLKQSETSTLLWKGTLDFGSTEAVNLNDSLDNYDLIEVTYWTRSAGHFSTKRLDIKNT SNLLYIRDFNISNDSTGSSVDFFEGYCTFPTRTSVQPGMVKSITLDGSTNTTKVASWNEK ERIKVYNIMGINRG The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html.  
101. T1000 All groups 523 A2 2018-06-25 2018-06-28 m1: 2018-07-02
m2: 2018-07-04
2018-07-16 D-galactarate dehydrogenase
PDB code 6u7l
102. S0975 Assisted - A1 2018-06-25 2018-06-28 - 2018-07-14 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
103. T0999 * All groups 1589 A2 2018-06-22 2018-06-25 m1: 2018-06-29
m2: 2018-07-01
2018-07-13 G0S061_CHATD
PDB code 6hqv
104. S0980s2 Assisted - A1 2018-06-22 2018-06-25 - 2018-07-08 This is a SAXS-assisted target representing the second subunit of the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
105. S0980s1 Assisted - A1 2018-06-22 2018-06-25 - 2018-07-08 This is a SAXS-assisted target representing the first subunit of the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
106. S0980 Assisted - A2B2 2018-06-22 2018-06-25 - 2018-07-08 This is a SAXS-assisted target representing the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
107. R0974s1 Refinement - - 2018-06-22 2018-06-25 - 2018-07-13 Starting model's GDT_HA=66. Residues 1 and 71-72 are absent from the target structure and deleted from the starting model.  
108. T0998 All groups 166 A2 2018-06-21 2018-06-24 m1: 2018-06-28
m2: 2018-06-30
2018-07-12 Bacteripohage AVE016 coat protein
PDB code 6yfb
109. T0997 * All groups 228 A2 2018-06-21 2018-06-24 m1: 2018-06-28
m2: 2018-06-30
2018-07-12 Q6MN59
110. T0996 All groups 848 A6 2018-06-20 2018-06-23 m1: 2018-06-27
m2: 2018-06-29
2018-07-11 YebT
PDB code 6v0e
111. T0995 * All groups 330 A8 2018-06-19 2018-06-22 m1: 2018-06-26
m2: 2018-06-28
2018-07-10 UniProtKB - B3GNT7 (B3GNT7_BACPU)
112. T0994 All groups 585 A1 2018-06-18 2018-06-21
canceled on
2021-09-15
m1: 2018-06-25
m2: 2018-06-27
2018-07-09
canceled on
2021-09-15
Q79ER8_STAAU
Canceled: no structure.
113. T0993s2 All groups 109 A1 2018-06-15 2018-06-18 m1: 2018-06-22
m2: 2018-06-24
2018-07-06 MlaFA
PDB code 6xbd
114. T0993s1 All groups 269 A1 2018-06-15 2018-06-18 m1: 2018-06-22
m2: 2018-06-24
2018-07-06 MlaFA
PDB code 6xbd
115. H0993 * All groups 378 A2B2 2018-06-15 2018-06-18 - 2018-07-06 MlaFA
116. X0957s2 Assisted - A1 2018-06-14 2018-06-17 - 2018-07-02 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer44414@ebi.ac.uk
Password: wbhw7G4Q

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

117. X0957s1 Assisted - A1 2018-06-14 2018-06-17 - 2018-07-02 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer44414@ebi.ac.uk
Password: wbhw7G4Q

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

118. X0957 Assisted - A1B1 2018-06-14 2018-06-17 - 2018-07-02 This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer44414@ebi.ac.uk
Password: wbhw7G4Q

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

119. T0992 All groups 126 A1 2018-06-14 2018-06-17 m1: 2018-06-21
m2: 2018-06-23
2018-07-05 Q6MKZ7
120. T0991 All groups 118 A2 2018-06-14 2018-06-17 m1: 2018-06-21
m2: 2018-06-23
2018-07-05 Bacteriophage ESE001 coat protein
PDB code 6yfj
121. R0968s2 Refinement - - 2018-06-14 2018-06-17 - 2018-07-04 Starting model's GDT_HA=50.  
122. R0968s1 Refinement - - 2018-06-14 2018-06-17 - 2018-07-04 Starting model's GDT_HA=45. Residues 1-5 and 124-126 are absent from the target structure and deleted from the starting model.  
123. T0990 All groups 552 A1 2018-06-13 2018-06-16 m1: 2018-06-20
m2: 2018-06-22
2018-07-04 NS1
PDB code 6n9y
124. X0953s2 Assisted - A1 2018-06-12 2018-06-15 - 2018-07-01 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094
and use the following credentials to login:
Username: reviewer70721@ebi.ac.uk
Password: M9rdkSXT

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.  

125. X0953s1 Assisted - A1 2018-06-12 2018-06-15 - 2018-07-01 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094
and use the following credentials to login:
Username: reviewer70721@ebi.ac.uk
Password: M9rdkSXT

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.  

126. X0953 Assisted - A3B1 2018-06-12 2018-06-15 - 2018-07-01 This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094
and use the following credentials to login:
Username: reviewer70721@ebi.ac.uk
Password: M9rdkSXT

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.  

127. T0989 All groups 246 A3 2018-06-12 2018-06-15 m1: 2018-06-19
m2: 2018-06-21
2018-07-03 Q6XQB2.1
128. T0988 * All groups 204 A3 2018-06-12 2018-06-15
canceled on
2018-06-29
m1: 2018-06-19
m2: 2018-06-21
2018-07-03
canceled on
2018-06-29
YP_006383572
Canceled: identical to T0881 in CASP12
129. T0987 All groups 405 A1 2018-06-11 2018-06-14 m1: 2018-06-18
m2: 2018-06-20
2018-07-02 Enterococcal surface protein
PDB code 6ori
130. S0968s2 Assisted - A1 2018-06-11 2018-06-14 - 2018-06-25 This is a SAXS-assisted target representing the second subunit of the H0968 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
131. S0968s1 Assisted - A1 2018-06-11 2018-06-14 - 2018-06-25 This is a SAXS-assisted target representing the first subunit of the H0968 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
132. S0968 Assisted - A2B2 2018-06-11 2018-06-14 - 2018-06-25 This is a SAXS-assisted target corresponding to H0968 complex. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
133. T0986s2 All groups 155 A1 2018-06-08 2018-06-11 m1: 2018-06-15
m2: 2018-06-17
2018-06-29 Toxic C-Terminal Tip of CdiA and Immune Protein
PDB code 6d7y
134. T0986s1 All groups 96 A1 2018-06-08 2018-06-11 m1: 2018-06-15
m2: 2018-06-17
2018-06-29 Toxic C-Terminal Tip of CdiA and Immune Protein
PDB code 6d7y
135. H0986 All groups 251 A1B1 2018-06-08 2018-06-11 - 2018-06-29 Toxic C-Terminal Tip of CdiA and Immune Protein
PDB code 6d7y
136. T0985 All groups 863 A1 2018-06-07 2018-06-10 m1: 2018-06-14
m2: 2018-06-16
2018-06-28 ACL_1061
137. T0984 * All groups 752 A2 2018-06-06 2018-06-09 m1: 2018-06-13
m2: 2018-06-15
2018-06-27 Q8NHX9
PDB code 6nq1
138. R0962 Refinement - - 2018-06-06 2018-06-09 - 2018-06-27 Starting model's GDT_HA=63 (on residues 2-178). Residues 1 and 179-220 are absent from the target and deleted from the starting model.  
139. T0983 * All groups 245 A2 2018-06-05 2018-06-08 m1: 2018-06-12
m2: 2018-06-14
2018-06-26 Cals10
PDB code 6uk5
140. T0982 Server only 283 A1 2018-06-05 2018-06-08 m1: 2018-06-12
m2: 2018-06-14
2018-06-16 DynU16
PDB code 6v04
141. R0959 Refinement - - 2018-06-05 2018-06-08 - 2018-06-25 Starting model's GDT_HA=45.  
142. R0957s2 Refinement - - 2018-06-05 2018-06-08 - 2018-06-26 Starting model's GDT_HA=39. Residues 1-6 are absent from the target structure and deleted from the starting model.  
143. T0981 All groups 640 A3 2018-06-04 2018-06-07 m1: 2018-06-11
m2: 2018-06-13
2018-06-25 gp146
144. T0980s2 All groups 52 A1 2018-06-01 2018-06-04 m1: 2018-06-08
m2: 2018-06-10
2018-06-22 Q3KP22-3; Q8NHR7
PDB code 6gnx
145. T0980s1 All groups 111 A1 2018-06-01 2018-06-04 m1: 2018-06-08
m2: 2018-06-10
2018-06-22 Q3KP22-3; Q8NHR7
PDB code 6gnx
146. R0958 Refinement - - 2018-06-01 2018-06-04
canceled on
2018-06-10
- 2018-06-17
canceled on
2018-06-10
Canceled - paper appeared online.  
147. H0980 All groups 163 A2B2 2018-06-01 2018-06-04 - 2018-06-22 Q3KP22-3; Q8NHR7
PDB code 6gnx
148. T0979 All groups 98 A3 2018-05-31 2018-06-03 m1: 2018-06-07
m2: 2018-06-09
2018-06-21 A0A0G1XU35_9BACT
PDB code 7o92
149. T0978 Server only 416 A1 2018-05-31 2018-06-03 m1: 2018-06-07
m2: 2018-06-09
2018-06-09 DpdA, WP_001542917.1
150. S0957s2 Assisted - A1 2018-05-31 2018-06-03 - 2018-06-14 This is a SAXS-assisted target representing the second subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
151. S0957s1 Assisted - A1 2018-05-31 2018-06-03 - 2018-06-14 This is a SAXS-assisted target representing the first subunit of the H0957 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
152. S0957 Assisted - A1B1 2018-05-31 2018-06-03 - 2018-06-14 This is a SAXS-assisted target. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
153. R0949 Refinement - - 2018-05-31 2018-06-03 - 2018-06-21 Starting model's GDT_HA=49. Residues 1-42, 96-105 and 182-183 are not ordered in the crystal structure and deleted from the starting model. The structure contains a bound Cu ion.  
154. T0977 All groups 566 A3 2018-05-30 2018-06-02 m1: 2018-06-06
m2: 2018-06-08
2018-06-20 YP_004957431.1
155. T0976 * All groups 252 A2 2018-05-29 2018-06-01 m1: 2018-06-05
m2: 2018-06-07
2018-06-19 Rhodanese-like family protein
PDB code 6mxv
156. T0975 All groups 343 A1 2018-05-29 2018-06-01 m1: 2018-06-05
m2: 2018-06-07
2018-06-19 EXO5
PDB code 7lw8
157. S0953s2 Assisted - A1 2018-05-29 2018-06-01 - 2018-06-12 This is a SAXS-assisted target representing the second subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
158. S0953s1 Assisted - A1 2018-05-29 2018-06-01 - 2018-06-12 This is a SAXS-assisted target representing the first subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
159. S0953 Assisted - A3B1 2018-05-29 2018-06-01 - 2018-06-12 This is a SAXS-assisted target. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
160. T0974s2 Server only 95 A1 2018-05-25 2018-05-28 m1: 2018-06-01
m2: 2018-06-03
2018-06-03 O48503/O48504
PDB code 6tri
161. T0974s1 All groups 72 A1 2018-05-25 2018-05-28 m1: 2018-06-01
m2: 2018-06-03
2018-06-15 O48503/O48504
PDB code 6tri
162. H0974 * All groups 167 A1B1 2018-05-25 2018-05-28 - 2018-06-15 O48503/O48504
163. T0973 * All groups 146 A2 2018-05-24 2018-05-27 m1: 2018-05-31
m2: 2018-06-02
2018-06-14 Bacteriophage ESE058 coat protein
PDB code 6yfn
164. T0972 All groups 106 A1 2018-05-24 2018-05-27
canceled on
2018-09-13
m1: 2018-05-31
m2: 2018-06-02
2018-06-14
canceled on
2018-09-13
Q0P914_CAMJE
Canceled: no structure.
165. T0971 Server only 186 A1 2018-05-23 2018-05-26 m1: 2018-05-30
m2: 2018-06-01
2018-06-02 nuclear transport factor 2
PDB code 6d34
166. T0970 All groups 97 A2 2018-05-23 2018-05-26 m1: 2018-05-30
m2: 2018-06-01
2018-06-13 Q6ZWB6
PDB code 6g57
167. T0969 All groups 487 A1 2018-05-22 2018-05-25 m1: 2018-05-29
m2: 2018-05-31
2018-06-12 XOAT1
PDB code 6cci
168. S0949 Assisted - A1 2018-05-22 2018-05-25 - 2018-06-10 This is a SAXS-assisted target. The data were collected on the full length protein. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
169. T0962 Server only 220 A1 2018-05-21 2018-05-24 m1: 2018-05-28
m2: 2018-05-30
2018-05-30 Endolysin KPP12
170. T0961 * All groups 505 A4 2018-05-21 2018-05-24 m1: 2018-05-28
m2: 2018-05-30
2018-06-11 Q6MJ59
PDB code 6sd8
171. T0968s2 All groups 116 A1 2018-05-18 2018-05-21 m1: 2018-05-25
m2: 2018-05-27
2018-06-08 B5Y0C2
PDB code 6cp9
172. T0968s1 All groups 126 A1 2018-05-18 2018-05-21 m1: 2018-05-25
m2: 2018-05-27
2018-06-08 B5Y0C2
PDB code 6cp9
173. H0968 All groups 242 A2B2 2018-05-18 2018-05-21 - 2018-06-08 B5Y0C2
PDB code 6cp9
174. T0967 Server only 81 A1 2018-05-17 2018-05-20 m1: 2018-05-24
m2: 2018-05-26
2018-05-26 MamB, Magnetosome protein
PDB code 6qfj
175. T0966 * All groups 494 A2 2018-05-17 2018-05-20 m1: 2018-05-24
m2: 2018-05-26
2018-06-07 Ras/Rap1 site-specific endopeptidase
PDB code 5w6l
176. T0965 * All groups 334 A2 2018-05-16 2018-05-19 m1: 2018-05-23
m2: 2018-05-25
2018-06-06 NADP reductase
PDB code 6d2v
177. T0964 All groups 184 A1 2018-05-16 2018-05-19 m1: 2018-05-23
m2: 2018-05-25
2018-06-06 CBM56
178. T0963 All groups 372 A3 2018-05-15 2018-05-18 m1: 2018-05-22
m2: 2018-05-24
2018-06-05 PA0620
PDB code 6cl6
179. T0960 All groups 384 A3 2018-05-11 2018-05-16 m1: 2018-05-20
m2: 2018-05-22
2018-06-05 PALES_06171
PDB code 6cl5
180. T0959 All groups 189 A1 2018-05-10 2018-05-15 m1: 2018-05-19
m2: 2018-05-21
2018-06-05 Endolysin ARW58837.1
181. T0958 All groups 96 A1 2018-05-10 2018-05-15 m1: 2018-05-19
m2: 2018-05-21
2018-05-31 LP1413
PDB code 6btc
182. T0957s2 All groups 164 A1 2018-05-09 2018-05-15 m1: 2018-05-19
m2: 2018-05-21
2018-05-30 CdiA_CdiI-CPX200209
PDB code 6cp8
183. T0957s1 All groups 163 A1 2018-05-09 2018-05-15 m1: 2018-05-19
m2: 2018-05-21
2018-05-30 CdiA_CdiI-CPX200209
PDB code 6cp8
184. H0957 All groups 327 A1B1 2018-05-09 2018-05-15 - 2018-05-30 CdiA_CdiI-CPX200209
PDB code 6cp8
185. T0956 All groups 178 A1 2018-05-08 2018-05-14
canceled on
2018-09-13
m1: 2018-05-18
m2: 2018-05-20
2018-05-29
canceled on
2018-09-13
K0A2T3
Canceled: no structure.
186. T0955 All groups 41 A1 2018-05-08 2018-05-14 m1: 2018-05-18
m2: 2018-05-20
2018-05-29 gHEEE_02
PDB code 5w9f
187. T0954 All groups 350 A1 2018-05-07 2018-05-13 m1: 2018-05-17
m2: 2018-05-19
2018-05-28 RFWD3_HUMAN
PDB code 6cvz
188. T0953s2 All groups 249 A1 2018-05-04 2018-05-10 m1: 2018-05-14
m2: 2018-05-16
2018-05-25 Adhesin tip
PDB code 6f45
189. T0953s1 All groups 72 A1 2018-05-04 2018-05-10 m1: 2018-05-14
m2: 2018-05-16
2018-05-25 Adhesin tip
PDB code 6f45
190. T0951 Server only 276 A1 2018-05-03 2018-05-09 m1: 2018-05-13
m2: 2018-05-15
2018-05-15 ShHTL7
PDB code 5z82
191. H0953 All groups 321 A3B1 2018-05-04 2018-05-07 - 2018-05-25 Adhesin tip
PDB code 6f45
192. T0952 All groups 35 A2 2018-05-03 2018-05-06
canceled on
2018-05-04
m1: 2018-05-10
m2: 2018-05-12
2018-05-24
canceled on
2018-05-04
O48503
PDB code 6fxa
Canceled: paper released before the prediction deadline.
193. T0950 Server only 353 An 2018-05-02 2018-05-05 m1: 2018-05-09
m2: 2018-05-11
2018-05-15 PaxB
PDB code 6ek4
Reclassified to server only (paper released before the human deadline)
194. T0949 All groups 183 A1 2018-05-01 2018-05-04 m1: 2018-05-08
m2: 2018-05-10
2018-05-21 B7JAQ5_ACIF2
Protein Structure Prediction Center
Sponsored by the US National Institute of General Medical Sciences (NIH/NIGMS)
Please address any questions or queries to:
© 2007-2018, University of California, Davis