CASP2 Target T0015
Received Tue Jun 4 2:35:44 BST 1996
- 1. Protein Name
- nadph:fmn oxidoreductase
- 2. Organism Name
- vibrio harveyi
- 3. Number of amino acids (approx)
- 240
- 4. Accession number
- U08996
- 5. Sequence Database
- Genbank
- 6. Amino acid sequence
- MNNTIETILAHRSIRKFTAVPITDEQRQTIIQAGLAASSSSMLQVVSIVR
VTDSEKRNELAQFAGNQAYVESAAEFLVFCIDYQRHATINPDVQADFTEL
TLIGAVDSGIMAQNCLLAAESMGLGGVYIGGLRNSAAQVDELLGLPENSA
VLFGMCLGHPDQNPEVKPRLPAHVVVHENQYQELNLDDIQSYDQTMQAYY
ASRTSNQKLSTWSQEVTGKLAGESRPHILPYLNSKGLAKR
- 7. Homologous Sequence of known structure
- yes
- 8. Current state of the experimental work
- The structure is finished and will be submitted for
publication within a few days. The release date
given below reflects an estimate of 6 months between
the time the manuscript is submitted and the time it appears
in print.
- 9. Interpretable map?
- yes
- 10. Estimated date of chain tracing completion
- done
- 11. Estimated date of public release of structure
- November 1997
- 13. Name
- Prof. Kurt L. Krause
- 14. Mailing address
- University of Houston
Dept. of Biochemical and Biophysical Sciences
Houston, TX 77204-5934
- 15. Telephone
- 713-743-8370
- 16. Fax
- 713-743-8373
- 17. Email
- kkrause@uh.edu
- 18. Source of information about experiment
- I am a veteran target provider
- 12. Additional Information
- Our enzyme shares 30 % sequence identity with nadh oxidase
from thermus thermophilus, which as been solved. See Hecht
et al., (1995) Nature Struc. Biol. 2, 1109-1114.
Related Files
Template Sequence file
Template PDB file