CASP2 Target T0030
Received Tue Aug 6 13:23:46 BST 1996
- 1. Protein Name
- domain 1 of protein g3
- 2. Organism Name
- filamentous phage fd
- 3. Number of amino acids (approx)
- 66
- 4. Accession number
- COAA_BPFD P03661
- 5. Sequence Database
- Swiss-prot
- 6. Amino acid sequence
- ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDET
QCYGTWVPIGLAIPEN
- 7. Homologous Sequence of known structure
- no
- 8. Current state of the experimental work
- structure determination by NMR completed
- 9. Interpretable map?
- no
- 10. Estimated date of chain tracing completion
- completed
- 11. Estimated date of public release of structure
- October 1996
- 13. Name
- Philipp Holliger, Lutz Riechmann
- 14. Mailing address
- Centre for Protein Engineering
MRC Centre
Cambridge
CB2 2QH
- 15. Telephone
- +44 1223 402100
- 16. Fax
- +44 1223 402140
- 17. Email
- ph1@mrc-lmb.cam.ac.uk
- 18. Source of information about experiment
- from one of the organisers
- 12. Additional Information
- Stengele, et al. (1990) JMB 212, 143-149
Related Files
Template Sequence file
Template PDB file