CASP2 Target T0037
Received Mon Aug 19 15:10:04 BST 1996
- 1. Protein Name
- calponon homology domain of beta-spectrin
- 2. Organism Name
- Homo sapiens
- 3. Number of amino acids (approx)
- 110
- 4. Accession number
- M96803
- 5. Sequence Database
- EMBL
- 6. Amino acid sequence
- KSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDF
DKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMK
- 7. Homologous Sequence of known structure
- no
- 8. Current state of the experimental work
- Structure was solved by MIR methods and is now refined to
2.0 A resolution with current R=0.160.
- 9. Interpretable map?
- yes
- 10. Estimated date of chain tracing completion
- is completed
- 11. Estimated date of public release of structure
- by the end of the year 1996
- 13. Name
- Kristina Djinovic Carugo
- 14. Mailing address
- EMBL
Meyerhofstrasse,1
Postfach 10.22.09
D-6900 Heidelberg
Germany
- 15. Telephone
- +49 6221 387 401, +49 6221 387 343
- 16. Fax
- +49 6221 387 306
- 17. Email
- djinovic@embl-heidelberg.de
- 18. Source of information about experiment
- Email
- 12. Additional Information
- J. Castresana, M Saraste (1995), FEBS Letters, 374, 149-151.
Related Files
Template Sequence file
Template PDB file