CASP2 Target T0042

Received Tue Oct 1 12:05:42 BST 1996

1. Protein Name: NK-lysin
2. Organism Name: pig
3. Number of amino acids (approx): 78
4. Accession number
5. Sequence Database
6. Amino acid sequence: GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
7. Homologous Sequence of known structure: no
8. Current state of the experimental work: Finished but unpublished NMR structure in aqueous solution
From natural source
9. Interpretable map?: yes
10. Estimated date of chain tracing completion: done
11. Estimated date of public release of structure: January 97
13. Name: Gottfried Otting
14. Mailing address: Karolinska Institute
MBB
Doktorsringen 6A
S-171 77 Stockholm
15. Telephone: +46-8-7286804
16. Fax: +46-8-335296
17. Email: go@mfn.ki.se
18. Source of information about experiment: Andrew Torda, ANU
12. Additional Information: Disulfide bridges: 4-76, 7-70, 35-45 (EMBO J. 14, 1615 (1995)
Sequence homology with a family of membrane binding proteins
(see FEBS Lett. 362, 328 (1995), all of unknown 3D structure.
NK-lysin has antibacterial and antitumor activity.