CASP3 Target T0050

1. Protein Name: Glutamate mutase, component S
2. Organism Name: Clostridium cohlearium
3. Number of amino acids (approx): 1240 (compE 483, compS 137)
4. Accession number: X80997
5. Sequence Database: EMBL
6. Amino acid sequence: >gi|2127335|pir||I40658 methylaspartate mutase (EC 5.4.99.1) component S - Clostridium cochlearium
MEKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQEVFIKAAIETKADAILLSSLYGQGEID
CKGLRQKCDEAGLEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDLNIE
>gi|2127336|pir||I40662 methylaspartate mutase (EC 5.4.99.1) conponent E - Clostridium cochlearium
MELKNKKWTDEEFHKQREEVLQQWPTGKEVDLQEAVDYLKKIPAEKNFAEKLVLAKKKGITMAQPRAGVA
LLDEHIELLRYLQDEGGADFLPSTIDAYTRQNRYDECENGIKESEKAGRSLLNGFPGVNYGVKGCRKVLE
AVNLPLQARHGTPDSRLLAEIIHAGGWTSNEGGGISYNVPYAKNVTIEKSLLDWQYCDRLVGFYEEQGVH
INREPFGPLTGTLVPPSMSNAVGITEALLAAEQGVKNITVGYGECGNMIQDIAALRCLEEQTNEYLKAYG
YNDVFVTTVFHQWMGGFPQDESKAFGVIVTATTIAALAGATKVIVKTPHEAIGIPTKEANAAGIKATKMA
LNMLEGQRMPMSKELETEMAVIKAETKCILDKMFELGKGDLAIGTVKAFETGVMDIPFGPSKYNAGKMMP
VRDNLGCVRYLEFGNVPFTEEIKNYNRERLQERAKFEGRDVSFQMVIDDIFAVGKGRLIGRPE
7. Homologous Sequence of known structure: yes
8. Current state of the experimental work: We have two heavyatom derivatives and native dataset.
Crystals diffract to 1.7 Angstrom.
Even though at the moment structure determination is running
very positively, we can not incure that the structure is
ready 1. September 1998.
9. Interpretable map?: no
10. Estimated date of chain tracing completion: Summer 1998
11. Estimated date of public release of structure: End of 1998
12. Additional Information: Glutamate mutase is a HETEROTETRAMER, composed of two components S and E.
The component S shows high sequence similarity with the B12-binding domains
of methylmalonyl CoA mutase (P. shermanii) and methionine synthase (E. coli).
13. Name: unavailable until after public release of structure

Note: There is a published NMR structure of the protein closely related to target T0050 (82% sequence similarity, no indels). Please, see:
Tollinger M; Konrat R; Hilbert BH; Marsh ENG; Kraeutler B. How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum. Structure 1998, 6:1021-1033.

The structure of this protein is available from PDB under accession code 1BE1.

Related Files

Template Sequence file

Template PDB file