CASP3 Target T0064
This is chain A (SinR) of complex formed by SinR and SinI.
Predictions in all formats for this chain should be submitted
as T0064.
Target T0066 (complex of SinR and SinI) is reserved only for
atomic coordinate prediction (TS) of the complex and for prediction
of interchain residue-residue contacts (RR).
-
1. Protein Name
- SinR
-
2. Organism Name
- Bacillus subtilis
-
3. Number of amino acids (approx)
- 111
-
4. Accession number
- P06533
-
5. Sequence Database
- Swiss-Prot
-
6. Amino acid sequence
- SinI
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAAR
SHTVNPF
##################################################
SinR
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKV
SAVLDVSVHTLLDEKHETEYDGQLDSEWEKLVRDAMTSGVSKKQFREFLD
YQKWRKSQKEE
-
7. Homologous Sequence of known structure
- no
-
8. Current state of the experimental work
-
X-ray structure solved and refined of the heterodimeric
complex of SinI and SinR. Manuscript submitted.
-
9. Interpretable map?
- yes
-
10. Estimated date of chain tracing completion
- finished
-
11. Estimated date of public release of structure
- september 1998
-
12. Additional Information
-
13. Name
- Dr. Rick Lewis
-
14. Mailing address
-
Department of Chemistry
University of York, York
North Yorkshire YO1 5DD
U.K.
-
15. Telephone
- +44 (0)1904 432590
-
16. Fax
- +44 (0)1904 410519
-
17. Email
- rick@yorvic.york.ac.uk
-
18. Source of information about experiment
- Email
Note: Some structural information regarding structure of the target
has been released in the form of an abstract. The abstract is
appended below.
THE CRYSTAL STRUCTURE OF SINR, AN INHIBITOR OF SPORULATION IN BACILLUS SUBTILIS
IN COMPLEX WITH ITS ANTAGONIST SINI
R.J. Lewis, J.A. Brannigan, W. Offen, I. Smith & A.J. Wilkinson
Department of Chemistry, University of York, York. U.K.
_________________________________________________________________
Amongst a panoply of molecular components which regulate the entry of
Bacillus subtilis into the sporulation pathway are the proteins of the
sin (sporulation inhibition) operon. The sin region encodes two
proteins SinR (Mr = 14,000) and SinI (Mr = 6,000). SinR is a DNA
binding protein which negatively regulates the transcription of genes,
including spo0A, spoIIA, spoIIE and spoIIG, in late phase Bacillus
growth. The effects exerted by SinR must be overcome in order for the
sporulation process to proceed. SinI, which is encoded on the same
operon as SinR but subject to different regulatory signals, acts as an
antagonist of SinR through direct binding of the two proteins. This
interaction involves an interesting subunit reorganisation;
equilibrium sedimentation experiments indicate that SinR is a tetramer
and that SinI as also multimeric. In contrast, the SinR-SinI complex
is a heterodimer.
We have recently solved the crystal structure of SinR in complex with
SinI to 1.9 Å spacing. The phases were calculated using data collected
from two selenium derivatives, in the first of these SinR contained
seleno- methionine, in the second of these SinI contained
selenomethionine. In the crystal, the SinI-SinR complex is, as
expected, a heterodimer. SinR consists of an N-terminal 66 residue
domain with very high structural similarity to the DNA binding domain
of bacteriophage 434 and [lambda] CI (repressor) proteins including a
helix-turn-helix DNA binding motif. A somewhat disordered region of 10
or so residues connects this domain to the C-terminal 40 residues
which are involved in interactions with SinI. The interactions between
SinI and SinR appear to be strong with a pair of helices from each
partner interdigitating to form a significant hydrophobic core. Most
interestingly, it has been noted that the central 30 residues of SinI
and the 30 residues towards the C-terminus of SinR have closer
sequence similarity to one another than either has to any other
sequence in the database. This suggests that the interactions among
SinR monomers in the tetramer may be akin to those between SinR and
SinI in the heterodimer.
Related Files
Template Sequence file
Template PDB file