CASP3 Target T0067
-
1. Protein Name
- Phosphatidylethanolamine Binding Protein
-
2. Organism Name
- Human
-
3. Number of amino acids (approx)
- 187
-
4. Accession number
- P30086
-
5. Sequence Database
- Swiss-prot
-
6. Amino acid sequence
-
MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDS
GKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRY
VWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKL
YEQLSGK
-
7. Homologous Sequence of known structure
- no
-
8. Current state of the experimental work
-
Determination of the 3D structure of this protein to high
resolution has been completed. The co-ordinates have been
deposited with the PDB but are "ON HOLD" until publication.
Basically, this means once the paper is published I have to
tell the PDB they can release the co-ordinates. I am quite
happy not to tell them until a date that will no longer
affect your CASP3 experiments.
-
9. Interpretable map?
- yes
-
10. Estimated date of chain tracing completion
-
Complete already
-
11. Estimated date of public release of structure
-
See Above (Current state).
-
12. Additional Information
-
The phosphatidylethaolamine binding protein family contains
homologues in many diverse species. They have no detectable
homology to other proteins.
During the course of sequence/structure analysis, a signature
for the sequence of this protein family (very highly conserved)
has been seen (also detected by SWISS-PROT - PROSITE.
This comprises:
[FY]-x-[LIVMF](3)-x-[DC]-P-D-x-P-[SN]-x(10)-H
begining at residue [FY]64 and ending at H86.
-
13. Name
- Dr Mark Banfield
-
14. Mailing address
-
Dept. of Biochemistry, University of Bristol
University Walk
BRISTOL BS8 1TD
U.K.
-
15. Telephone
- 44-(0)117 9289000
-
16. Fax
- 44-(0)117 9288274
-
17. Email
- m.banfield@bris.ac.uk
-
18. Source of information about experiment
-
I have previously heard of CASP through email, but
this submission was at the suggestion of Dr Alexey Murzin,
LMB Cambridge.
Related Files
Template Sequence file
Template PDB file