PFRMAT RR TARGET T0311 AUTHOR SAM_T06_server REMARK From group SAM-TO6 under the direction of REMARK Kevin Karplus. REMARK Residue-residue contact predictions REMARK by George Shackelford and Kevin Karplus REMARK The value given is an approximation of the probability REMARK as provided by the neural network. REMARK The predictions are limited to a score >= .18 which REMARK is an approximation of the probability. REMARK METHOD The predictor is an artificial neural network. METHOD NN: logseploglen.5xt04_ent.5xnearNS_str2.miRpz_entR_pplR.n45.net METHOD Inputs may include separation and sequence length, METHOD e-value statistic based on mutual information values, METHOD a statistic based on propensity of residues in contact. METHOD Other inputs are distributions from alignments and METHOD secondary predictions from SAM-t04 and/or SAM-t06 of METHOD the University of California, Santa Cruz METHOD ------------- MODEL 1 MKMANHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTP EMAIKLSVVIGSSPQMWLNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 9 23 0 8 0.258495070031 9 24 0 8 0.2632698591 9 49 0 8 0.252665975786 9 53 0 8 0.254162041662 9 64 0 8 0.26407433201 9 74 0 8 0.287593255007 12 70 0 8 0.255542950478 13 24 0 8 0.254917068602 13 27 0 8 0.35094995314 13 28 0 8 0.297150634981 13 31 0 8 0.265421409373 13 38 0 8 0.270899320169 13 41 0 8 0.516610773068 13 42 0 8 0.259395507157 13 48 0 8 0.302542649682 13 52 0 8 0.273701485149 13 53 0 8 0.259093626502 13 56 0 8 0.501875151899 13 60 0 8 0.327284970213 13 66 0 8 0.25443757282 16 27 0 8 0.29357759025 16 38 0 8 0.260238691056 16 56 0 8 0.256237796468 17 27 0 8 0.404302190106 17 28 0 8 0.263759113955 17 31 0 8 0.257520789253 17 38 0 8 0.263835885328 17 41 0 8 0.404780253165 17 53 0 8 0.259267663302 17 56 0 8 0.313321136523 22 38 0 8 0.259631351419 24 34 0 8 0.305557675481 24 35 0 8 0.261236718912 24 37 0 8 0.263636149636 24 38 0 8 0.346511441771 24 39 0 8 0.256364013811 24 40 0 8 0.252602541812 24 52 0 8 0.280582045198 24 59 0 8 0.252981519143 27 38 0 8 0.567383091438 27 41 0 8 0.366762444162 27 42 0 8 0.464887456163 27 52 0 8 0.359267131059 27 53 0 8 0.264124103281 27 56 0 8 0.626786094423 27 59 0 8 0.398600059364 27 70 0 8 0.255315889382 28 37 0 8 0.277020182336 28 38 0 8 0.294995833124 28 41 0 8 0.385252619469 28 42 0 8 0.301077258599 28 52 0 8 0.33358474898 28 53 0 8 0.391799346563 28 56 0 8 0.514113118512 28 59 0 8 0.25898887912 28 60 0 8 0.288773828571 28 70 0 8 0.389479402655 30 59 0 8 0.260065955466 31 41 0 8 0.270686185345 31 42 0 8 0.257015269276 31 53 0 8 0.36646642978 31 56 0 8 0.366421824873 33 55 0 8 0.253302917944 37 52 0 8 0.357175048474 37 59 0 8 0.395530410184 38 48 0 8 0.264942889498 38 52 0 8 0.608571933229 38 53 0 8 0.338779154702 38 54 0 8 0.255056298042 38 56 0 8 0.481825717056 38 59 0 8 0.452162778619 38 60 0 8 0.420528271067 38 70 0 8 0.278130088919 41 52 0 8 0.631290613354 41 53 0 8 0.442888663771 41 54 0 8 0.296326697616 41 56 0 8 0.47484634895 41 60 0 8 0.341873376119 41 70 0 8 0.256959642561 42 52 0 8 0.308645740696 42 53 0 8 0.471099800889 42 56 0 8 0.603914903378 48 64 0 8 0.253974667462 48 70 0 8 0.254588187845 50 64 0 8 0.261266321433 53 64 0 8 0.269217423851 53 66 0 8 0.286624870839 53 67 0 8 0.600782982718 53 70 0 8 0.360394723288 53 74 0 8 0.256140531042 56 66 0 8 0.364308742857 56 67 0 8 0.286673552597 56 70 0 8 0.457046789972 57 67 0 8 0.311508957396 57 70 0 8 0.28135360502 60 70 0 8 0.332925742857 67 79 0 8 0.259467398995 END