PFRMAT TS TARGET T0350 AUTHOR Huber-Torda-server REMARK This is a multi-part message in MIME format. REMARK REMARK --1RK1S1C6KL-=-1CE9YLV4A8-CUT-HERE-1ATZNE55YM-=-1WJG99P3OV REMARK Content-Type: text/plain; charset=us-ascii REMARK Content-Transfer-Encoding: 7bit REMARK Content-Disposition: inline REMARK REMARK Title: "T0350" REMARK Results sent to "servers@predictioncenter.org" REMARK Library from pdb90.list with 12339 template structures. REMARK Brief results printed for 50 templates. REMARK Long alignments printed for 10 templates. REMARK Models made for the best 10 models. REMARK Models will be sent as 10 attachments per file REMARK Sequence length 117 is REMARK MNIERLTTLQ PVWDRYDTQI HNQKDNDNEV PVHQVSYTNL AEMVGEMNKL LEPSQVHLKF REMARK ELHDKLNEYY VKVIEDSTNE VIREIPPKRW LDFYAAMTEF LGLFVDEKKL EHHHHHH REMARK REMARK REMARK REMARK sw refers to Smith and Waterman alignment, nw refers to Needleman & Wunsch REMARK z scr : the z-score of the alignment with 1000 alternative alignments REMARK sw scr: the combined results of score function + gaps for sw alignment REMARK sw cvr: coverage (fraction of sequence) accounted for by sw alignment REMARK nw cvr: coverage accounted for by nw alignment REMARK sw1 : score of sw alignment in first score function REMARK sw2 : score of sw alignment in second score function REMARK ____________ Summary of best templates _________________________________ REMARK struct z scr sw scr sw cvr nw cvr sw1 sw2 REMARK 1zkoA 4.9e+02 39.5 0.04 0.043 39 0 REMARK 1g5hA 19 117.1 0.84 0.84 1.1e+02 4.8e+02 REMARK 1jmwA 18 82.6 0.94 0.96 72 3.9e+02 REMARK 2a8aA 18 81.1 0.91 0.92 66 4.6e+02 REMARK 1y1oA 18 75.1 0.82 0.84 69 4.6e+02 REMARK 1ztuA 18 85.2 0.77 0.84 80 3.6e+02 REMARK 1orjA 18 100.1 0.91 0.91 87 3.9e+02 REMARK 1bmfA 18 77.9 0.87 0.89 68 4.7e+02 REMARK 1kytA 18 59.4 0.64 0.79 48 4.1e+02 REMARK 1iku_ 18 71.4 0.85 0.85 56 4.4e+02 REMARK 1d8sA 18 75.1 0.83 0.83 68 4.3e+02 REMARK 1i60A 17 70.0 0.82 0.82 57 5.4e+02 REMARK 1dchA 17 62.0 0.80 0.8 47 4.9e+02 REMARK 1ywmA 17 82.7 0.91 0.91 81 4.1e+02 REMARK 1u6tA 17 98.7 0.82 0.82 1e+02 3.1e+02 REMARK 1l3pA 17 73.9 0.85 0.85 61 4.4e+02 REMARK 1owsA 17 54.1 0.85 0.86 45 3.7e+02 REMARK 1x42A 17 76.9 0.79 0.79 66 4e+02 REMARK 1dw0A 17 49.8 0.77 0.77 33 3.6e+02 REMARK 1do0A 17 72.2 0.87 0.89 57 4.3e+02 REMARK 1vcsA 17 81.2 0.75 0.76 65 5.3e+02 REMARK 1oyjA 17 63.8 0.79 0.81 58 3.4e+02 REMARK 2aizP 17 57.8 0.79 0.85 49 3.7e+02 REMARK 1mh7A 17 54.0 0.85 0.86 45 4e+02 REMARK 2gqfA 17 68.6 0.95 0.95 66 4.3e+02 REMARK 1fazA 17 57.4 0.85 0.87 41 4.2e+02 REMARK 1oftA 17 55.3 0.80 0.85 52 3.9e+02 REMARK 2fvtA 17 96.4 0.85 0.85 1e+02 2.9e+02 REMARK 1b4uB 17 67.1 0.91 0.96 65 3.8e+02 REMARK 1ru0A 16 60.4 0.79 0.79 48 4.2e+02 REMARK 1xkpB 16 66.5 0.72 0.77 51 4.6e+02 REMARK 1cpcA 16 64.3 0.93 0.97 51 3.8e+02 REMARK 1wypA 16 63.5 0.78 0.79 54 4e+02 REMARK 1zu2A 16 100.1 0.91 0.91 1e+02 3.1e+02 REMARK 2adzA 16 60.0 0.87 0.87 42 3.7e+02 REMARK 1gtmA 16 61.9 0.69 0.69 58 3.7e+02 REMARK 102l_ 16 59.2 0.90 0.94 51 3.2e+02 REMARK 1wqfA 16 73.6 0.92 0.92 57 3.9e+02 REMARK 1diiA 16 65.0 0.87 0.89 54 3.5e+02 REMARK 1kyqA 16 74.2 0.85 0.86 69 3.6e+02 REMARK 1dd5A 16 75.4 0.89 0.91 57 4.7e+02 REMARK 1ljrA 16 64.5 0.91 0.92 58 3.1e+02 REMARK 1b8dA 16 63.5 0.88 0.89 59 3.4e+02 REMARK 1vl5A 16 63.4 0.84 0.86 59 3.5e+02 REMARK 1t6sA 16 77.0 0.88 0.91 71 4.5e+02 REMARK 1gwiA 16 75.9 0.99 0.99 77 4e+02 REMARK 2choA 16 69.8 0.96 0.97 63 4.1e+02 REMARK 1rxqA 16 78.2 0.97 0.97 75 4e+02 REMARK 1ci4A 16 50.2 0.60 0.64 39 4e+02 REMARK 1cf5A 16 58.4 0.76 0.77 55 2.7e+02 REMARK REMARK ____________ Summary of coverage of query sequence _______________________ REMARK S & W coverage with 1zkoA REMARK ----------------------------------------------------------------------------------------------------------------XXXXX REMARK S & W coverage with 1g5hA REMARK XXXXXX--XXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXX---X-XX---XXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXX- REMARK S & W coverage with 1jmwA REMARK -XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXX--XXXXXXXXX- REMARK S & W coverage with 2a8aA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXX-X-X-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1y1oA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXXX----------XXXXX--XXXXXXXXXXXXXX-XXXXXXXXXXXXX--XXXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1ztuA REMARK --------XXXXXXXXXXXXXXXXXXXXXX----XXXXXX-XXXXXXXXXX-----XXXXXXXXXX--XXXXXXXXXX---XXXXXXX-XXXXXXXXXXXXXXXX---XXXXXXXXX REMARK S & W coverage with 1orjA REMARK XXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXX-X--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXX-- REMARK S & W coverage with 1bmfA REMARK XXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXX--XXXXXXXXX-XXXXXXXXXXX-XXXXXXXXXX-XXXXXX----XXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1kytA REMARK -------------------XX--XXXXXXX-XXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXX----------XXXXX-XXXXXXXXXXXXXXXX----XXXXXXXX REMARK S & W coverage with 1iku_ REMARK XXXXXXXXXXXXXXXXX-XXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXX----XXX------ REMARK S & W coverage with 1d8sA REMARK XXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXX--X-XXXXXXXXXXXXXXX-XXXXX-XXX-XXXXXXXXXX--X-XXXXXXXXXXXXXXXXXXXXXXXX-XX---XX------ REMARK S & W coverage with 1i60A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX--XXX---------XXXXXXXXXX-XX-XXX-XXXXXXXXXXXXXXXXXXXX------XXXX REMARK S & W coverage with 1dchA REMARK XXXXXXXXXXXXXXXX--XXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXX-XXXXXXXXXXXXX--XX--X-XXXXXXXXXXXXXXXXXXX------------ REMARK S & W coverage with 1ywmA REMARK XXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1u6tA REMARK XXXXX------XXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXX----XX--XXXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1l3pA REMARK XXXXXXXXXX-XXXXXXXXXXXXXXX---XXXXXX-XXXXXXXXXXXXXXXXXXXXXXXX-X-XXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----- REMARK S & W coverage with 1owsA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XX-XXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 1x42A REMARK -----------XXXXXXXXX---------XXX-XXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1dw0A REMARK XXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXXXXXXXXX----------------- REMARK S & W coverage with 1do0A REMARK XXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXX------XXXXXX-XXXX---- REMARK S & W coverage with 1vcsA REMARK ------XXXX-XXXXXXXXXXX--------------X--XXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXX- REMARK S & W coverage with 1oyjA REMARK --XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXX-XXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXX-------------- REMARK S & W coverage with 2aizP REMARK ---------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 1mh7A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XX-XXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 2gqfA REMARK XXXXXXXXXXXXX--XXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1fazA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXX-X---XX------- REMARK S & W coverage with 1oftA REMARK -----XXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXX----XXX--XXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 2fvtA REMARK XXXXXXXXX--XX--XXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXX REMARK S & W coverage with 1b4uB REMARK -----XXXXXXXXXXXXXXXXXXXXXXX-XXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1ru0A REMARK XXXXXXXXX---XXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXX--X--X-XXXXXXXXXXXXXXXXXX------------- REMARK S & W coverage with 1xkpB REMARK -----XXXXXX-X-XXXXXXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXX------------ REMARK S & W coverage with 1cpcA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---- REMARK S & W coverage with 1wypA REMARK -----------------XXXXXXXXXXXXXXXXX--XXXXXXXXXX---X---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1zu2A REMARK XXXXXXX-------XXXXXXXXXX---XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 2adzA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-------------- REMARK S & W coverage with 1gtmA REMARK XXXXXXXXXX-XX--XXXXXXXXXXXXXXX----XXXXXXXXX------------------XXXXXXXXXXXXX-----XXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXX----- REMARK S & W coverage with 102l_ REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-X---XXXXXXX-XXXXXXXXXX----- REMARK S & W coverage with 1wqfA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX REMARK S & W coverage with 1diiA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--------XXXXXXX---XXXXXXX--XXXXXXX-- REMARK S & W coverage with 1kyqA REMARK XXXXXXX-X--XXXXXXXXXXXXX----XXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--- REMARK S & W coverage with 1dd5A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--------XXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXX-- REMARK S & W coverage with 1ljrA REMARK XXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXX-------XXXXXXXXXXXXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1b8dA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--X------- REMARK S & W coverage with 1vl5A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXXXXX-XX-------XXXXXXXXXXXXXXXX--- REMARK S & W coverage with 1t6sA REMARK --XXXXXX--XXXXXXXXXXX-X--XXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXX--- REMARK S & W coverage with 1gwiA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 2choA REMARK -XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1rxqA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1ci4A REMARK -----XXXXXXXXXXXXXXXXXXX------------XXXXXXXXXX----X----XXXXX-XXXXXXXXXXXXX---------XXXXXXXXXXXXXXXXXXXXXX------------ REMARK S & W coverage with 1cf5A REMARK --------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK REMARK ____________ Best detailed alignments ______________________________ REMARK __________________________________________________________________________ REMARK Alignment to 1zkoA REMARK z-score is 491.7 sw cover: 0.04 nw cover 0.04 REMARK Seq ID 100 % (5 / 5) in 5 total including gaps REMARK : REMARK : REMARK : REMARK hhhhh REMARK hhhhh REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1g5hA REMARK z-score is 19.11 sw cover: 0.84 nw cover 0.84 REMARK Seq ID 14.3 % (14 / 98) in 121 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK mnierlttlqpvwdryd---tqihnqkdndnevpvhqvsytnlaemvgemnkllepsqvh REMARK velrqv--cqgllnellengisvwpgysetvhs-----sleqlhsky---d-em---svl REMARK : 3 : 3 : 3 : 3 : REMARK : 1 : 2 : 3 : 4 : REMARK : 0 : 0 : 0 : 0 : REMARK REMARK 0 : 0 : 0 : 0 : 1 : 1 : REMARK 6 : 7 : 8 : 9 : 0 : 1 : REMARK 0 : 0 : 0 : 0 : 0 : 0 : REMARK lkfelhdklney-yvkviedstnevireippkrwldfya-amteflglfvdekklehhhh REMARK fsvlvtettlengliqlrsrdtt-mkemmhisklrdflvkylasasnvaaa---ldhhhh REMARK 3 : 3 : 3 : 3 : 3 : 4 REMARK 5 : 6 : 7 : 8 : 9 : 0 REMARK 0 : 0 : 0 : 0 : 0 : 0 REMARK REMARK REMARK REMARK REMARK h REMARK h REMARK : REMARK : REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1jmwA REMARK z-score is 18.41 sw cover: 0.94 nw cover 0.96 REMARK Seq ID 10.9 % (12 / 110) in 128 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 REMARK : 0 : 0 : 0 : 0 : 0 REMARK nierlttlqpvwdrydtqihnqkdndnevpvhqv---sytnlaemvgemn---kll-eps REMARK twdlmlqtrinlarsaarmmmdasnqqssaktdllqnakttlaqaaahyanfknmtplpa REMARK : 3 : 4 : 5 : 6 : 7 : 8 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK REMARK : 0 : 0 : 0 : 0 : 1 : REMARK : 6 : 7 : 8 : 9 : 0 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK qvhlkfel---hdklneyy---vkviedstnevireippkrwldfyaamteflglfvdek REMARK maeasanvdekyqryqaalaeliqfldngnmdayfaqptqgmqn---algealgnya--r REMARK : 0 : 1 : 1 : 1 : 1 : REMARK : 9 : 0 : 1 : 2 : 3 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK REMARK 1 : REMARK 1 : REMARK 0 : REMARK klehhhhh REMARK vsenlyrq REMARK 1 REMARK 4 REMARK 0 REMARK REMARK __________________________________________________________________________ REMARK Alignment to 2a8aA REMARK z-score is 18.25 sw cover: 0.91 nw cover 0.92 REMARK Seq ID 17 % (18 / 106) in 125 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : 6 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK mnierlttlqpvwdrydtqihnqkdndnevpvhqvsytnlaemvgemnkllepsqvhlkf REMARK halhglygargvtyeetievkqaplmiaekp---irleefltfggqdlniit-s-a-mke REMARK : 2 : 2 : 2 : 2 : 2 REMARK : 3 : 4 : 5 : 6 : 7 REMARK : 0 : 0 : 0 : 0 : 0 REMARK REMARK : 0 : 0 : 0 : 1 : 1 REMARK : 7 : 8 : 9 : 0 : 1 REMARK : 0 : 0 : 0 : 0 : 0 REMARK elhdklneyyvkvied--stnevireippkrwldfyaamteflgl--------fvdekkl REMARK kiynnllanyekiatrlsevnsappeydineykdyf---qwkygldknadgsytvnenkf REMARK : 2 : 2 : 3 : 3 : 3 : 3 REMARK : 8 : 9 : 0 : 1 : 2 : 3 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK REMARK : REMARK : REMARK : REMARK ehhhh REMARK neiyk REMARK : REMARK : REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1y1oA REMARK z-score is 18.17 sw cover: 0.82 nw cover 0.84 REMARK Seq ID 13.5 % (13 / 96) in 125 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 REMARK : 0 : 0 : 0 : 0 : 0 REMARK mnierlttlqp-------vwdrydtqihn-qkdndnevpvhqvsytnlaemvgemnklle REMARK aviteayfrqasttdyngvyrgkyidfeaketknktafplknfhahq----irhmeqvv- REMARK : 5 : 6 : 7 : 8 : 9 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK REMARK : 0 : 0 : 0 : 0 : 1 : 1 REMARK : 6 : 7 : 8 : 9 : 0 : 1 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK psqvhlkfelhdklneyyvkviedstnevireippkrwldfyaamteflglf--vdekkl REMARK ---------ahggi--cfailrfsllnety-lldashliawwnk--qeaggrksipkqei REMARK 1 : 1 : 1 : 1 : 1 REMARK 0 : 1 : 2 : 3 : 4 REMARK 0 : 0 : 0 : 0 : 0 REMARK REMARK : REMARK : REMARK : REMARK ehhhh REMARK erhgh REMARK : REMARK : REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1ztuA REMARK z-score is 17.92 sw cover: 0.77 nw cover 0.84 REMARK Seq ID 17.8 % (16 / 90) in 111 total including gaps REMARK 1 : 2 : 3 : 4 : 5 : 6 : REMARK 0 : 0 : 0 : 0 : 0 : 0 : REMARK lqpvwdrydtqihnqkdndnevpvhqvsytnlaemvg--emnkllepsqvhlkfelhdkl REMARK ldpvlntqtnaptplggavlra----tspmhm-qylrnmgvgssl-----svsvvvggql REMARK : 2 : 2 : 2 : 2 : 2 REMARK : 3 : 4 : 5 : 6 : 7 REMARK : 0 : 0 : 0 : 0 : 0 REMARK REMARK 0 : 0 : 0 : 1 : 1 : REMARK 7 : 8 : 9 : 0 : 1 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK neyyvkviedstnevireippkrwldfyaamteflglfvdekklehhhhhh REMARK --wgliachhqt---pyvlppd-lrttleylgrllslqv---qvkeahhhh REMARK : 2 : 2 : 3 : 3 REMARK : 8 : 9 : 0 : 1 REMARK : 0 : 0 : 0 : 0 REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1orjA REMARK z-score is 17.89 sw cover: 0.91 nw cover 0.91 REMARK Seq ID 13.2 % (14 / 106) in 116 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : 6 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK mnierlttlqpvwdrydtqihnqkdndnevpvhqvsytnlaemvgemnkllepsqvhlkf REMARK qiillydkaieclerai-eiydqvnelekrkefvenidrvydiisalksfldhekgk--- REMARK 2 : 3 : 4 : 5 : 6 : 7 : REMARK 0 : 0 : 0 : 0 : 0 : 0 : REMARK REMARK : 0 : 0 : 0 : 1 : 1 : REMARK : 7 : 8 : 9 : 0 : 1 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK elhdklneyyvkviedstnevireippkrwldfyaamteflglfvd-ekklehhhh REMARK eiaknldtiytiilnt-l--vkvdktkeelqkileilkdlreaweevkkkv--hhh REMARK 0 : 0 : 1 : 1 : 1 : REMARK 8 : 9 : 0 : 1 : 2 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1bmfA REMARK z-score is 17.85 sw cover: 0.87 nw cover 0.89 REMARK Seq ID 12.7 % (13 / 102) in 121 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK mnierl-ttlqpvwdrydtqihnqkdndnevpvhqvsytnlaemvgemnkllepsqvhlk REMARK ramkqvagtmklelaqyr-evaafaqfgsdldaa--tqqllsrgv-rltellkqgqy-sp REMARK 3 : 3 : 3 : 3 : 4 : 4 REMARK 6 : 7 : 8 : 9 : 0 : 1 REMARK 0 : 0 : 0 : 0 : 0 : 0 REMARK REMARK 0 : 0 : 0 : 0 : 1 : 1 REMARK 6 : 7 : 8 : 9 : 0 : 1 REMARK 0 : 0 : 0 : 0 : 0 : 0 REMARK felhdklneyyvkviedstnevireippkrwldfyaamteflglfv--dek---klehhh REMARK maieeqva-viyagv----rgyldklepskitkfena---flshvisqhqallgkirtdg REMARK : 4 : 4 : 4 : 4 : 4 REMARK : 2 : 3 : 4 : 5 : 6 REMARK : 0 : 0 : 0 : 0 : 0 REMARK REMARK : REMARK : REMARK : REMARK h REMARK k REMARK : REMARK : REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1kytA REMARK z-score is 17.73 sw cover: 0.64 nw cover 0.79 REMARK Seq ID 21.3 % (16 / 75) in 98 total including gaps REMARK 2 : 3 : 4 : 5 : 6 : 7 : REMARK 0 : 0 : 0 : 0 : 0 : 0 : REMARK ihnqkdndnevpvhqvsytnlaemvgemnkllepsqvhlkfelhdklneyyvkviedstn REMARK im--fdndgsi-kkffsnegtnkfleemsk-----rtsmrsiltnrwreastgf------ REMARK 0 : 0 : 0 : 1 : 1 : REMARK 7 : 8 : 9 : 0 : 1 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK REMARK 0 : 0 : 1 : 1 : REMARK 8 : 9 : 0 : 1 : REMARK 0 : 0 : 0 : 0 : REMARK evireippkrwldfyaamteflglfvdekklehhhhhh REMARK ----didpe-dvdyvrkeaesrgfvi----fysgyswh REMARK 1 : 1 : 1 REMARK 2 : 3 : 4 REMARK 0 : 0 : 0 REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1iku_ REMARK z-score is 17.54 sw cover: 0.85 nw cover 0.85 REMARK Seq ID 19 % (19 / 100) in 114 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK mnierlttlqpvwdrydtqihnqkdndnevpvhqvsytnlaemvgemnkllepsqv-hl- REMARK vialhmtsagktnqkle-wafslydvdgn---gtisknevleivtaifkmispedtkhlp REMARK 0 : 1 : 1 : 1 : 1 : 1 REMARK 9 : 0 : 1 : 2 : 3 : 4 REMARK 0 : 0 : 0 : 0 : 0 : 0 REMARK REMARK 0 : 0 : 0 : 0 : 1 : 1 REMARK 6 : 7 : 8 : 9 : 0 : 1 REMARK 0 : 0 : 0 : 0 : 0 : 0 REMARK kfelh-dklneyyvkviedstnevireippkrwldfyaamteflglfvdekkle REMARK edentpekraekiwgffgkkddd---kltekefiegtlankeilrli----qfe REMARK : 1 : 1 : 1 : 1 : REMARK : 5 : 6 : 7 : 8 : REMARK : 0 : 0 : 0 : 0 : REMARK REMARK Writing models for 10 structures REMARK __________________________________________________________________________ REMARK Wurst gegessen at Wed Jun 28 19:49:38 2006 REMARK I took 67:29 min user and 0:28 min sys time REMARK Run on node17 REMARK REMARK --1RK1S1C6KL-=-1CE9YLV4A8-CUT-HERE-1ATZNE55YM-=-1WJG99P3OV REMARK Content-Type: chemical/x-pdb REMARK Content-Transfer-Encoding: 7bit REMARK Content-Disposition: attachment; REMARK filename="1zkoA.pdb" REMARK METHOD ------------- REMARK SCORE 491.656 MODEL 1 PARENT 1zko_A REMARK Wed 28 Jun 2006 07:49:38 PM CEST REMARK Now the original sequence follows. It probably has more REMARK residues than the model below. REMARK SEQRES 1 117 MET ASN ILE GLU ARG LEU THR THR LEU GLN PRO VAL TRP REMARK SEQRES 2 117 ASP ARG TYR ASP THR GLN ILE HIS ASN GLN LYS ASP ASN REMARK SEQRES 3 117 ASP ASN GLU VAL PRO VAL HIS GLN VAL SER TYR THR ASN REMARK SEQRES 4 117 LEU ALA GLU MET VAL GLY GLU MET ASN LYS LEU LEU GLU REMARK SEQRES 5 117 PRO SER GLN VAL HIS LEU LYS PHE GLU LEU HIS ASP LYS REMARK SEQRES 6 117 LEU ASN GLU TYR TYR VAL LYS VAL ILE GLU ASP SER THR REMARK SEQRES 7 117 ASN GLU VAL ILE ARG GLU ILE PRO PRO LYS ARG TRP LEU REMARK SEQRES 8 117 ASP PHE TYR ALA ALA MET THR GLU PHE LEU GLY LEU PHE REMARK SEQRES 9 117 VAL ASP GLU LYS LYS LEU GLU HIS HIS HIS HIS HIS HIS ATOM 1 N HIS 113 -4.372 16.017 55.237 1.00 1.00 ATOM 2 CA HIS 113 -3.614 15.969 53.956 1.00 1.00 ATOM 3 C HIS 113 -3.369 14.535 53.535 1.00 1.00 ATOM 4 O HIS 113 -3.094 13.670 54.367 1.00 1.00 ATOM 5 CB HIS 113 -2.292 16.721 54.085 1.00 1.00 ATOM 6 N HIS 114 -3.467 14.303 52.234 1.00 1.00 ATOM 7 CA HIS 114 -3.400 12.964 51.674 1.00 1.00 ATOM 8 C HIS 114 -2.146 12.794 50.837 1.00 1.00 ATOM 9 O HIS 114 -1.632 13.768 50.283 1.00 1.00 ATOM 10 CB HIS 114 -4.666 12.683 50.871 1.00 1.00 ATOM 11 N HIS 115 -1.642 11.562 50.782 1.00 1.00 ATOM 12 CA HIS 115 -0.411 11.250 50.061 1.00 1.00 ATOM 13 C HIS 115 -0.495 11.692 48.602 1.00 1.00 ATOM 14 O HIS 115 -1.407 11.302 47.872 1.00 1.00 ATOM 15 CB HIS 115 -0.125 9.748 50.164 1.00 1.00 ATOM 16 N HIS 116 0.457 12.521 48.188 1.00 1.00 ATOM 17 CA HIS 116 0.489 13.022 46.823 1.00 1.00 ATOM 18 C HIS 116 0.845 11.906 45.854 1.00 1.00 ATOM 19 O HIS 116 1.784 11.154 46.094 1.00 1.00 ATOM 20 CB HIS 116 1.521 14.142 46.718 1.00 1.00 ATOM 21 N HIS 117 0.078 11.803 44.773 1.00 1.00 ATOM 22 CA HIS 117 0.421 10.919 43.670 1.00 1.00 ATOM 23 C HIS 117 1.584 11.517 42.893 1.00 1.00 ATOM 24 O HIS 117 1.795 12.729 42.911 1.00 1.00 ATOM 25 CB HIS 117 -0.741 10.761 42.703 1.00 1.00 TER END