PFRMAT TS TARGET T0352 AUTHOR Huber-Torda-server REMARK This is a multi-part message in MIME format. REMARK REMARK --15OII1D2PO-=-1N7LF194N5-CUT-HERE-1X9RWIN0NW-=-839DIVKOLE REMARK Content-Type: text/plain; charset=us-ascii REMARK Content-Transfer-Encoding: 7bit REMARK Content-Disposition: inline REMARK REMARK Title: "T0352" REMARK Results sent to "servers@predictioncenter.org" REMARK Library from pdb90.list with 12339 template structures. REMARK Brief results printed for 50 templates. REMARK Long alignments printed for 10 templates. REMARK Models made for the best 10 models. REMARK Models will be sent as 10 attachments per file REMARK Sequence length 117 is REMARK MTTHDRVRLQ LQALEALLRE HQHWRNDEPQ PHQFNSTQPF FMDTMEPLEW LQWVLIPRMH REMARK DLLDNKQPLP GAFAVAPYYE MALATDHPQR ALILAELEKL DALFADDASL EHHHHHH REMARK REMARK REMARK REMARK sw refers to Smith and Waterman alignment, nw refers to Needleman & Wunsch REMARK z scr : the z-score of the alignment with 1000 alternative alignments REMARK sw scr: the combined results of score function + gaps for sw alignment REMARK sw cvr: coverage (fraction of sequence) accounted for by sw alignment REMARK nw cvr: coverage accounted for by nw alignment REMARK sw1 : score of sw alignment in first score function REMARK sw2 : score of sw alignment in second score function REMARK ____________ Summary of best templates _________________________________ REMARK struct z scr sw scr sw cvr nw cvr sw1 sw2 REMARK 1vlvA 1.3e+03 39.5 0.04 0.043 39 0 REMARK 2amlA 7.7e+02 39.5 0.04 0.043 39 0 REMARK 1zkoA 5e+02 39.5 0.04 0.043 39 0 REMARK 2afbA 4.1e+02 39.5 0.04 0.043 40 0 REMARK 1d8sA 18 92.4 0.87 0.87 79 3.6e+02 REMARK 1nu5A 18 57.7 0.67 0.75 45 5.7e+02 REMARK 1t6iA 18 69.7 0.83 0.83 58 4.8e+02 REMARK 1b48A 17 78.4 0.83 0.86 62 4.8e+02 REMARK 1hbrA 17 64.9 0.78 0.84 54 4.6e+02 REMARK 1orjA 17 78.7 0.85 0.85 73 4.1e+02 REMARK 1zu2A 17 98.5 1.00 1 1.1e+02 2.9e+02 REMARK 1emsA 17 66.6 0.86 0.94 62 3.6e+02 REMARK 1ev4A 17 73.7 0.85 0.86 55 4.9e+02 REMARK 1ywmA 17 75.5 0.69 0.74 68 3.6e+02 REMARK 2bv9A 17 98.6 0.81 0.81 1e+02 3.4e+02 REMARK 1q0dA 17 63.0 0.64 0.64 51 4.2e+02 REMARK 1jogA 17 70.6 0.93 0.94 60 3.9e+02 REMARK 1mo0A 17 56.2 0.78 0.82 44 4.6e+02 REMARK 1vpe_ 17 63.2 0.93 0.95 58 3.7e+02 REMARK 1qniA 17 54.8 0.75 0.85 43 3.8e+02 REMARK 1dik_ 17 58.7 0.84 0.87 52 4.4e+02 REMARK 1ji6A 17 72.0 0.85 0.86 62 4.2e+02 REMARK 1v70A 17 48.8 0.68 0.71 42 3.7e+02 REMARK 1wa5C 17 70.0 0.79 0.79 62 3.7e+02 REMARK 1ihgA 16 60.8 0.90 0.96 50 3.9e+02 REMARK 1php_ 16 60.2 0.95 0.97 55 3.6e+02 REMARK 1sqfA 16 69.3 0.84 0.84 66 4.4e+02 REMARK 1uvhA 16 69.3 0.86 0.87 66 4e+02 REMARK 1obcA 16 71.7 0.93 0.94 62 4e+02 REMARK 1vkpA 16 54.7 0.79 0.83 50 4e+02 REMARK 2g7jA 16 68.4 0.87 0.88 51 5e+02 REMARK 1dpsA 16 68.5 0.84 0.84 61 4.4e+02 REMARK 1i45A 16 58.5 0.83 0.83 50 4.9e+02 REMARK 1v6sA 16 62.1 0.78 0.79 56 4e+02 REMARK 1hdiA 16 54.3 0.97 0.97 57 3.6e+02 REMARK 1o9rA 16 68.8 0.86 0.87 60 4.3e+02 REMARK 1wcuA 16 68.3 0.73 0.78 66 3.6e+02 REMARK 1nzeA 16 59.1 0.61 0.63 52 3.9e+02 REMARK 1sgmA 16 63.4 0.74 0.79 50 4.3e+02 REMARK 1kq3A 16 51.6 0.88 0.89 49 3.6e+02 REMARK 1i5pA 16 70.9 0.85 0.87 60 3.9e+02 REMARK 1ii5A 16 59.4 0.97 0.97 62 4.4e+02 REMARK 1ezwA 16 49.7 0.95 0.98 53 4.1e+02 REMARK 1t43A 16 52.3 0.90 0.94 56 3.1e+02 REMARK 2etnA 16 60.8 0.79 0.79 53 3.5e+02 REMARK 2f84A 16 60.0 0.84 0.85 62 3.6e+02 REMARK 1rr9A 16 49.8 0.94 0.98 41 4.2e+02 REMARK 1ny8A 16 89.1 0.76 0.79 88 3.2e+02 REMARK 1nt2A 16 68.5 0.87 0.95 64 4.1e+02 REMARK 1gqeA 16 73.1 0.79 0.8 63 4.6e+02 REMARK REMARK ____________ Summary of coverage of query sequence _______________________ REMARK S & W coverage with 1vlvA REMARK ----------------------------------------------------------------------------------------------------------------XXXXX REMARK S & W coverage with 2amlA REMARK ----------------------------------------------------------------------------------------------------------------XXXXX REMARK S & W coverage with 1zkoA REMARK ----------------------------------------------------------------------------------------------------------------XXXXX REMARK S & W coverage with 2afbA REMARK ----------------------------------------------------------------------------------------------------------------XXXXX REMARK S & W coverage with 1d8sA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 1nu5A REMARK ---XXXXXXXXXXXXXXXXX-------------XXXXXXXXXXXXXXXXXXX-XXXXX---XXX---------XXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 1t6iA REMARK XXXXXXXXXXXXXXXXXXXX---XXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 1b48A REMARK --XXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXX-------XXXXXXXXXXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1hbrA REMARK --------XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXX--XXXXXX-----XXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXX-----XXXXXXXX REMARK S & W coverage with 1orjA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXX--------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXX-- REMARK S & W coverage with 1zu2A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1emsA REMARK ------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXXXX--- REMARK S & W coverage with 1ev4A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXX-------XXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1ywmA REMARK -----XXXXXXXXXXXXXXXXXXXXX--------XXXXXX----XXXXXXXXXXXXXXXXXXXXX-XXXX------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 2bv9A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXX--------XXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXX---XXXXXX---XXXXXXXXX REMARK S & W coverage with 1q0dA REMARK XXXXXXXXXXXXXXXXXXX-----------------------XXXXXX-X--XXXXXXXXXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------- REMARK S & W coverage with 1jogA REMARK --XXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1mo0A REMARK XXXXXXXXXXXXXXXXXXX----XXXXXXX----XXXXXXXX--XXXXXXXX---------XXXXXXXX-XXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----- REMARK S & W coverage with 1vpe_ REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1qniA REMARK ------XXXXXXXXXXXXX-XXXXX----X--XXXXXXXXX-XXXXXXXXXXXXXXXX----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----- REMARK S & W coverage with 1dik_ REMARK XXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXX-------XXXXXXXXXXXXXX-X---XXXXXXXXXXXXXX-XXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---- REMARK S & W coverage with 1ji6A REMARK -XXXXXXXXXXXXXXXXXXXXXXXXX-----------XXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1v70A REMARK XXXXXXXXXXX-----XXX-----XXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXX-----X--XXX------------ REMARK S & W coverage with 1wa5C REMARK XXXXXXXXXXXXXXXXXXXXXXX----------------XXXXXX--XXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXX REMARK S & W coverage with 1ihgA REMARK ------XXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXX-XXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1php_ REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XX-XXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXX-- REMARK S & W coverage with 1sqfA REMARK XXXXXXXXX-XXXXXXXXXXXX----------XX---X-XXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXX REMARK S & W coverage with 1uvhA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXX---------XXXXXXX-XXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXX- REMARK S & W coverage with 1obcA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1vkpA REMARK -----XXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXX---X-XXXXXXXX--XXXXXX---XXXXXXXXXXXXXXXXXX----XXXXXXXXXXXXXXX------XXXXXXXX REMARK S & W coverage with 2g7jA REMARK ------XXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXX-X-----XXXXXXXXXXXXXX- REMARK S & W coverage with 1dpsA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXX-- REMARK S & W coverage with 1i45A REMARK XXXXXXXXXXXXXXXXXX---XXX-XXXX----XXXXXXXXX--XXXXXXXXX-----XXXXX--X--XXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1v6sA REMARK XXXXXXXXXXXXXXXXXXXX------XX-XXXXX------XXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXX- REMARK S & W coverage with 1hdiA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1o9rA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------------XXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXX- REMARK S & W coverage with 1wcuA REMARK ------XXXXXXXXXXXXX----XXXXXX----XXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXX-XXXXXX---XX----XXXXXXXXXXXX--XXXXXXXXXXXXXXX--- REMARK S & W coverage with 1nzeA REMARK --XXXXXXXXXXXXXXXXXX--------------------XXXXX-XXXXXXXXXXXXXXXXXXX-------------XXXXXXXXXXXXXXXXXXXXXXXXXXXX---X------- REMARK S & W coverage with 1sgmA REMARK -XXXXXXXXXXXXXXXXXXX-------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXX------ REMARK S & W coverage with 1kq3A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----X-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXX------- REMARK S & W coverage with 1i5pA REMARK --XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------X-XXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXX- REMARK S & W coverage with 1ii5A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1ezwA REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---- REMARK S & W coverage with 1t43A REMARK XXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXX----- REMARK S & W coverage with 2etnA REMARK XXXXXXXXXXXXXXXXXXXXX--XXXXXX-------XXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXXXXXXXXXXX------- REMARK S & W coverage with 2f84A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXXX--------XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXXXXXXX-XXXXXXXXXXXXXX--XX------ REMARK S & W coverage with 1rr9A REMARK XXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----- REMARK S & W coverage with 1ny8A REMARK --------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXX----------XXXXXXXXXXX--XXXX-XXXXXX-XX-----XXXXXXXX REMARK S & W coverage with 1nt2A REMARK ----------XXXXXXXXXXXXXX---X--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX REMARK S & W coverage with 1gqeA REMARK XXXXXXXXXXXXXXXXXX-XXXXXX-X--XXXXXX-----XX--XXXXXXXXXXXXXXXXXXXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXX- REMARK REMARK ____________ Best detailed alignments ______________________________ REMARK __________________________________________________________________________ REMARK Alignment to 1vlvA REMARK z-score is 1291 sw cover: 0.04 nw cover 0.04 REMARK Seq ID 100 % (5 / 5) in 5 total including gaps REMARK : REMARK : REMARK : REMARK hhhhh REMARK hhhhh REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 2amlA REMARK z-score is 773.7 sw cover: 0.04 nw cover 0.04 REMARK Seq ID 100 % (5 / 5) in 5 total including gaps REMARK : REMARK : REMARK : REMARK hhhhh REMARK hhhhh REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1zkoA REMARK z-score is 497.7 sw cover: 0.04 nw cover 0.04 REMARK Seq ID 100 % (5 / 5) in 5 total including gaps REMARK : REMARK : REMARK : REMARK hhhhh REMARK hhhhh REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 2afbA REMARK z-score is 406 sw cover: 0.04 nw cover 0.04 REMARK Seq ID 100 % (5 / 5) in 5 total including gaps REMARK : REMARK : REMARK : REMARK hhhhh REMARK hhhhh REMARK : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1d8sA REMARK z-score is 18.1 sw cover: 0.87 nw cover 0.87 REMARK Seq ID 11.8 % (12 / 102) in 112 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : 6 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK mtthdrvrlqlqaleallrehqhwrndepqphqfnstqpffmdtmeplewlqwvliprmh REMARK aaaaaaaaaaaaaaaaaaaaaaaaaaaaaa---aaaaaaaaaaaaaaaaaaaaaaaaaaa REMARK : 3 : 3 : 3 : 3 : 4 : REMARK : 6 : 7 : 8 : 9 : 0 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK REMARK : 0 : 0 : 0 : 1 : 1 REMARK : 7 : 8 : 9 : 0 : 1 REMARK : 0 : 0 : 0 : 0 : 0 REMARK dlldnkqplpgafavapyyemalatdhpqralilaelekldal-f-addasl REMARK aaa----aaaaaaaaaaaaaaaaaaaaaa-aaaaaaaaaaaaaaaaaaaaaa REMARK 4 : 4 : 4 : 4 : 4 : REMARK 1 : 2 : 3 : 4 : 5 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1nu5A REMARK z-score is 18.1 sw cover: 0.67 nw cover 0.75 REMARK Seq ID 20.5 % (16 / 78) in 119 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 REMARK : 0 : 0 : 0 : 0 : 0 REMARK hdrvrlq---------lqaleallrehqhwrndepqphqfnstqpffmdt-m-eplewlq REMARK hnrfkvklgartpaqdlehirsivka-------------vgdrasvrvdvnqgwdeqtas REMARK 1 : 1 : 1 : 1 : 2 : REMARK 6 : 7 : 8 : 9 : 0 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK REMARK : 0 : 0 : 0 : 0 : 1 : 1 REMARK : 6 : 7 : 8 : 9 : 0 : 1 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK wvliprmhdlldnkqplpgafavapyyemalatdhpqralilael-ekldalfaddasl REMARK -iwipr---lee---------agvelveqpvpran---fgalrrlteqngvailadesl REMARK 2 : 2 : 2 : 2 : REMARK 1 : 2 : 3 : 4 : REMARK 0 : 0 : 0 : 0 : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1t6iA REMARK z-score is 17.85 sw cover: 0.83 nw cover 0.83 REMARK Seq ID 14.4 % (14 / 97) in 123 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK mtthdrvrlqlqaleallrehqhwrndepqphqfnstqpffmdtmep----lewlq-wvl REMARK vydpaqarieaesvkavqek---mag-nddphfqtratvikeqraelakhhvsvlwsdyf REMARK : 1 : 2 : 3 : 4 : 5 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK REMARK 0 : 0 : 0 : 0 : 1 : REMARK 6 : 7 : 8 : 9 : 0 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK -------iprmhdlldnkqplpgafavapyyemalatdhpqral-ilaelekldalfadd REMARK kpphfekypelhqlvnd---------tlkamsaakgskdpatgqkaldyiaqidkifwet REMARK 0 : 0 : 0 : 0 : 1 : REMARK 6 : 7 : 8 : 9 : 0 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK REMARK 1 REMARK 1 REMARK 0 REMARK asl REMARK kka REMARK 1 REMARK 1 REMARK 0 REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1b48A REMARK z-score is 17.34 sw cover: 0.83 nw cover 0.86 REMARK Seq ID 13.4 % (13 / 97) in 117 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : 6 REMARK : 0 : 0 : 0 : 0 : 0 : 0 REMARK thdrvrl--qlqaleallrehqhwrndepqphqfnstqpffmdtmeplewlqwvliprmh REMARK lkervridmyadgtqdlmmmiavapfk--tpkekeesydlils------raktryfpvfe REMARK : 0 : 1 : 1 : 1 : 1 : REMARK : 9 : 0 : 1 : 2 : 3 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK REMARK : 0 : 0 : 0 : 1 : 1 : REMARK : 7 : 8 : 9 : 0 : 1 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK dlldn-kqplpgafavapyyemalatdhpqralilaeleklda-lfaddaslehhhh REMARK kilkdhgeaflvgnqls-wadiqll-------eailmveelsapvlsdfpllqafkt REMARK 1 : 1 : 1 : 1 : 1 : REMARK 4 : 5 : 6 : 7 : 8 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1hbrA REMARK z-score is 17.33 sw cover: 0.78 nw cover 0.84 REMARK Seq ID 14.3 % (13 / 91) in 112 total including gaps REMARK 1 : 2 : 3 : 4 : 5 : 6 : REMARK 0 : 0 : 0 : 0 : 0 : 0 : REMARK lqlqaleallrehqhwrndepqphq-fnstqpffmdtmeplewlqwvliprmhdlldnkq REMARK fgaealtrmfttypqtktyf--phfdlspgsdqvrghg--kkvlga-----lgnavknvd REMARK : 3 : 4 : 5 : 6 : 7 REMARK : 0 : 0 : 0 : 0 : 0 REMARK REMARK 0 : 0 : 0 : 1 : 1 : REMARK 7 : 8 : 9 : 0 : 1 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK plpgafavapyyem-alatdh-pqralilaelekldalfaddaslehhhhhh REMARK nl--sqamaelsnlhaynlrvdpvnfkllsqc--iqvvl-----avhmgkdy REMARK : 0 : 0 : 1 : 1 : REMARK : 8 : 9 : 0 : 1 : REMARK : 0 : 0 : 0 : 0 : REMARK REMARK __________________________________________________________________________ REMARK Alignment to 1orjA REMARK z-score is 17.08 sw cover: 0.85 nw cover 0.85 REMARK Seq ID 18.2 % (18 / 99) in 131 total including gaps REMARK : 1 : 2 : 3 : 4 : 5 : REMARK : 0 : 0 : 0 : 0 : 0 : REMARK mtthdrvrlqlqaleallrehqhwrndepqphqfnstqpffmdtmeplewlqwvl--ipr REMARK vetatpleqiillydkaiecleraie--------------iydqvnelekrkefvenidr REMARK : 2 : 3 : 4 : 5 : REMARK : 0 : 0 : 0 : 0 : REMARK REMARK 0 : 0 : 0 : 0 : 1 : REMARK 6 : 7 : 8 : 9 : 0 : REMARK 0 : 0 : 0 : 0 : 0 : REMARK mhdll---dnkqpl----pgafavapyyem----alatdhpqral--ilaelekldalfa REMARK vydiisalksfldhekgkeiaknldtiytiilntlvkvdktkeelqkileilkdlreawe REMARK 0 : 0 : 0 : 0 : 1 : 1 : REMARK 6 : 7 : 8 : 9 : 0 : 1 : REMARK 0 : 0 : 0 : 0 : 0 : 0 : REMARK REMARK 1 : REMARK 1 : REMARK 0 : REMARK d-daslehhhh REMARK evkkkv--hhh REMARK 1 : REMARK 2 : REMARK 0 : REMARK REMARK Writing models for 10 structures REMARK __________________________________________________________________________ REMARK Wurst gegessen at Wed Jun 28 20:13:00 2006 REMARK I took 67:47 min user and 0:28 min sys time REMARK Run on node19 REMARK REMARK --15OII1D2PO-=-1N7LF194N5-CUT-HERE-1X9RWIN0NW-=-839DIVKOLE REMARK Content-Type: chemical/x-pdb REMARK Content-Transfer-Encoding: 7bit REMARK Content-Disposition: attachment; REMARK filename="1vlvA.pdb" REMARK METHOD ------------- REMARK SCORE 1290.84 MODEL 1 PARENT 1vlv_A REMARK Wed 28 Jun 2006 08:12:59 PM CEST REMARK Now the original sequence follows. It probably has more REMARK residues than the model below. REMARK SEQRES 1 117 MET THR THR HIS ASP ARG VAL ARG LEU GLN LEU GLN ALA REMARK SEQRES 2 117 LEU GLU ALA LEU LEU ARG GLU HIS GLN HIS TRP ARG ASN REMARK SEQRES 3 117 ASP GLU PRO GLN PRO HIS GLN PHE ASN SER THR GLN PRO REMARK SEQRES 4 117 PHE PHE MET ASP THR MET GLU PRO LEU GLU TRP LEU GLN REMARK SEQRES 5 117 TRP VAL LEU ILE PRO ARG MET HIS ASP LEU LEU ASP ASN REMARK SEQRES 6 117 LYS GLN PRO LEU PRO GLY ALA PHE ALA VAL ALA PRO TYR REMARK SEQRES 7 117 TYR GLU MET ALA LEU ALA THR ASP HIS PRO GLN ARG ALA REMARK SEQRES 8 117 LEU ILE LEU ALA GLU LEU GLU LYS LEU ASP ALA LEU PHE REMARK SEQRES 9 117 ALA ASP ASP ALA SER LEU GLU HIS HIS HIS HIS HIS HIS ATOM 1 N HIS 113 202.871 176.009 57.135 1.00 1.00 ATOM 2 CA HIS 113 203.797 175.066 56.444 1.00 1.00 ATOM 3 C HIS 113 204.292 175.670 55.138 1.00 1.00 ATOM 4 O HIS 113 204.595 174.898 54.211 1.00 1.00 ATOM 5 CB HIS 113 203.102 173.725 56.053 1.00 1.00 ATOM 6 N HIS 114 204.409 177.009 55.058 1.00 1.00 ATOM 7 CA HIS 114 204.420 177.798 53.768 1.00 1.00 ATOM 8 C HIS 114 203.020 177.882 53.120 1.00 1.00 ATOM 9 O HIS 114 202.567 178.988 52.821 1.00 1.00 ATOM 10 CB HIS 114 205.419 177.306 52.720 1.00 1.00 ATOM 11 N HIS 115 202.397 176.731 52.836 1.00 1.00 ATOM 12 CA HIS 115 200.924 176.649 52.687 1.00 1.00 ATOM 13 C HIS 115 200.455 175.746 53.790 1.00 1.00 ATOM 14 O HIS 115 200.711 174.545 53.777 1.00 1.00 ATOM 15 CB HIS 115 200.448 176.134 51.319 1.00 1.00 ATOM 16 N HIS 116 199.798 176.350 54.770 1.00 1.00 ATOM 17 CA HIS 116 199.216 175.622 55.881 1.00 1.00 ATOM 18 C HIS 116 198.047 174.685 55.440 1.00 1.00 ATOM 19 O HIS 116 197.103 175.128 54.773 1.00 1.00 ATOM 20 CB HIS 116 198.755 176.652 56.923 1.00 1.00 ATOM 21 N HIS 117 198.117 173.405 55.826 1.00 1.00 ATOM 22 CA HIS 117 197.071 172.436 55.528 1.00 1.00 ATOM 23 C HIS 117 195.877 172.637 56.474 1.00 1.00 ATOM 24 O HIS 117 196.072 172.642 57.703 1.00 1.00 ATOM 25 CB HIS 117 197.584 170.990 55.674 1.00 1.00 TER END