PFRMAT RR TARGET T0359 REMARK No remarks METHOD Contact pairs of residues are predicted by a fully METHOD automated server using a trained Neural Network. METHOD The principle component of the encoding for the METHOD input to the network is pairs of "windows" of METHOD correlations, generated from a multiple sequence METHOD alignment, centered on the residue pair of interest. METHOD Inputs for predicted secondary structure, residue class, METHOD a residue "affinity" score, sequence length and METHOD residue separation are also included. METHOD Details of the method may be found in: METHOD "Protein contact prediction using patterns of correlation". METHOD N. Hamilton, K. Burrage, M. Ragan and T. Huber METHOD Proteins:Structure, Function and Bioinformatics. 56 (4), 2004, 679-684 METHOD ------------- MODEL 1 SMSETFDVELTKNVQGLGITIAGYIGDKKL EPSGIFVKSITKSSAVEHDGRIQIGDQIIA VDGTNLQGFTNQQAVEVLRHTGQTVLLTLM RRGETSV 21 85 0 8 0.540 21 65 0 8 0.417 7 37 0 8 0.414 6 37 0 8 0.403 10 36 0 8 0.396 6 89 0 8 0.385 36 57 0 8 0.376 21 60 0 8 0.368 36 85 0 8 0.362 6 38 0 8 0.361 11 21 0 8 0.356 59 85 0 8 0.350 10 22 0 8 0.336 10 37 0 8 0.335 37 43 0 8 0.317 11 36 0 8 0.315 58 87 0 8 0.311 60 85 0 8 0.303 36 62 0 8 0.291 10 35 0 8 0.287 23 39 0 8 0.285 36 84 0 8 0.281 6 12 0 8 0.279 11 23 0 8 0.277 11 59 0 8 0.277 59 86 0 8 0.276 26 43 0 8 0.276 21 37 0 8 0.275 36 86 0 8 0.272 38 60 0 8 0.268 37 60 0 8 0.267 37 58 0 8 0.265 58 86 0 8 0.264 21 84 0 8 0.263 21 40 0 8 0.262 34 66 0 8 0.262 37 44 0 8 0.261 60 84 0 8 0.259 23 35 0 8 0.257 35 85 0 8 0.257 21 36 0 8 0.254 23 71 0 8 0.250 35 63 0 8 0.247 10 85 0 8 0.247 6 59 0 8 0.247 38 58 0 8 0.246 36 58 0 8 0.240 7 38 0 8 0.237 11 85 0 8 0.236 40 89 0 8 0.236 61 85 0 8 0.234 10 61 0 8 0.233 8 35 0 8 0.233 37 49 0 8 0.231 25 35 0 8 0.230 36 61 0 8 0.228 9 36 0 8 0.227 38 89 0 8 0.224 64 85 0 8 0.223 61 86 0 8 0.223 65 85 0 8 0.223 8 89 0 8 0.222 60 86 0 8 0.221 34 40 0 8 0.221 12 21 0 8 0.220 24 59 0 8 0.218 21 61 0 8 0.217 40 78 0 8 0.216 58 85 0 8 0.216 22 63 0 8 0.215 37 85 0 8 0.215 35 62 0 8 0.213 65 84 0 8 0.212 60 89 0 8 0.210 23 34 0 8 0.210 23 50 0 8 0.210 23 43 0 8 0.210 30 44 0 8 0.209 22 39 0 8 0.209 60 66 0 8 0.208 37 57 0 8 0.207 22 85 0 8 0.207 58 64 0 8 0.206 23 91 0 8 0.206 6 36 0 8 0.204 60 83 0 8 0.203 21 58 0 8 0.202 8 58 0 8 0.202 35 64 0 8 0.200 10 60 0 8 0.197 63 68 0 8 0.196 35 58 0 8 0.196 59 87 0 8 0.196 23 62 0 8 0.195 37 84 0 8 0.195 11 60 0 8 0.194 22 86 0 8 0.194 END