
PFRMAT FRV1
REMARK ========================================================================
REMARK Threading results for the target T0004, compared against a minimal
REMARK database containing representative beta-proteins of 5 - 7 beta strands.
REMARK Program: "SCF-Threader" by Rykunov & Finkelstein, 1996
REMARK Theory: Finkelstein & Reva (1991) Nature 351:497-499
REMARK Papres: Finkelstein & Reva (1996) Prot.Eng.9:399-411
REMARK Papres: Reva & Finkelstein (1996) Prot.Eng.9:387-397
REMARK
REMARK "SCF-Threader" threads a target chain onto the secondary structures
REMARK taken from a template protein. In the given case, only the beta-
REMARK strands are used and alpha-helices are ignored. The template strands
REMARK are taken from the PDB structure and then EXTENDED theoretically,
REMARK so that the target chain can choose its optimal position at these
REMARK extended secondary structures. at Predicted strand can occupy all the
REMARK extended template strand or any part of it.
REMARK In the alignment, we present only that part of the predicted
REMARK strand which is aligned with the native strand of the protein.
REMARK Usually, the predicted strand is longer, but that part of it which
REMARK occupies the native strand's extension is not shown now: it cannot
REMARK be presented in the frames of the given format.
REMARK
REMARK ========================================================================
AUTHOR 7972-9465-6839 FINKELSTEIN Alexei V.  Institute of Protein Research,
AUTHOR 8338-5675-1272 RYKUNOV Dmitry S., Institute of Theor. & Exp. Biophys.
AUTHOR 7972-9465-6839           142292 Pushchino, Moscow Regoin, Russia
AUTHOR 7972-9465-6839             E-MAIL:   afinkel@sun.ipr.serpukhov.su
REMARK ========================================================================
SEQRES T0004 AEIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYL
SEQRES T0004 QMGQEVPVKVLEVDRQGRIRLSIKEATEQSQPAA
REMARK ========================================================================
TSCORE T0004 0  0.5     NONE - 0
TSCORE T0004 0  0.2     7FAB H 1
TSCORE T0004 0  0.0     1CDG - 1
TSCORE T0004 0  0.0     1HOE - 1
TSCORE T0004 0  0.3     1AZU - 1
TSCORE T0004 0  0.0     2GCR - 1
TSCORE T0004 0  0.0     1MJC - 1
TSCORE T0004 0  0.0     1BGH - 1
TSCORE T0004 0  0.0     2PIA - 1
TSCORE T0004 0  0.0     1EFT - 1
TSCORE T0004 0  0.0     1BCO - 1
TSCORE T0004 0  0.0     1HEF E 1
TSCORE T0004 0  0.0     1PLS - 1
REMARK ========================================================================
TALIGN T0004 0    4    8        7FAB H 1        124  128        1.0     1
REMARK This segment is predicted  1 res. at N-terminus &  1 res. at C-terminus longer
TALIGN T0004 0   12   19        7FAB H 1        142  149        1.0     1
TALIGN T0004 0   22   25        7FAB H 1        155  158        1.0     1
REMARK This segment is predicted  1 res. at N-terminus &  1 res. at C-terminus longer
TALIGN T0004 0   33   35        7FAB H 1        167  169        1.0     1
REMARK This segment is predicted  1 res. at N-terminus longer
TALIGN T0004 0   39   40        7FAB H 1        173  174        1.0     1
TALIGN T0004 0   46   53        7FAB H 1        180  187        1.0     1
TALIGN T0004 0   58   63        7FAB H 1        199  204        1.0     1
REMARK This segment is predicted  2 res. at N-terminus longer
TALIGN T0004 0   69   74        7FAB H 1        209  214        1.0     1
REMARK ========================================================================
TALIGN T0004 0    3    5        1AZU - 1          5    7        1.0     1
REMARK This segment is predicted  2 res. at N-terminus longer
TALIGN T0004 0   14   15        1AZU - 1         20   21        1.0     1
REMARK This segment is predicted  2 res. at N-terminus &  2 res. at C-terminus longer
TALIGN T0004 0   20   25        1AZU - 1         28   33        1.0     1
REMARK This segment is predicted  1 res. at N-terminus longer
TALIGN T0004 0   34   37        1AZU - 1         49   52        1.0     1
REMARK This segment is predicted  2 res. at N-terminus longer
TALIGN T0004 0   46   51        1AZU - 1         93   98        1.0     1
REMARK This segment is predicted  1 res. at C-terminus longer
TALIGN T0004 0   58   61        1AZU - 1        108  111        1.0     1
REMARK This segment is predicted  2 res. at N-terminus &  2 res. at C-terminus longer
TALIGN T0004 0   69   72        1AZU - 1        123  126        1.0     1
REMARK This segment is predicted  2 res. at C-terminus longer
REMARK ========================================================================
STRSUB 7FAB H 1 124  128
STRSUB 7FAB H 1 140  149
STRSUB 7FAB H 1 155  158
STRSUB 7FAB H 1 167  169
STRSUB 7FAB H 1 173  174
STRSUB 7FAB H 1 180  188
STRSUB 7FAB H 1 199  204
STRSUB 7FAB H 1 209  214
REMARK ========================================================================
STRSUB 1CDG - 1 586  594
STRSUB 1CDG - 1 603  608
STRSUB 1CDG - 1 636  643
STRSUB 1CDG - 1 647  656
STRSUB 1CDG - 1 659  662
STRSUB 1CDG - 1 668  671
STRSUB 1CDG - 1 678  683
REMARK ========================================================================
STRSUB 1HOE - 1  12   16
STRSUB 1HOE - 1  20   25
STRSUB 1HOE - 1  31   37
STRSUB 1HOE - 1  46   48
STRSUB 1HOE - 1  52   58
STRSUB 1HOE - 1  67   72
REMARK ========================================================================
STRSUB 1AZU - 1   5    8
STRSUB 1AZU - 1  20   21
STRSUB 1AZU - 1  28   34
STRSUB 1AZU - 1  49   52
STRSUB 1AZU - 1  93   98
STRSUB 1AZU - 1 108  111
STRSUB 1AZU - 1 122  126
REMARK ========================================================================
STRSUB 2GCR - 1   3    6
STRSUB 2GCR - 1  15   18
STRSUB 2GCR - 1  34   37
STRSUB 2GCR - 1  41   45
STRSUB 2GCR - 1  54   57
STRSUB 2GCR - 1  60   62
STRSUB 2GCR - 1  77   81
REMARK ========================================================================
STRSUB 1MJC - 1   5   13
STRSUB 1MJC - 1  18   23
STRSUB 1MJC - 1  30   33
STRSUB 1MJC - 1  50   56
STRSUB 1MJC - 1  63   69
REMARK ========================================================================
STRSUB 1BGH - 1   4    6
STRSUB 1BGH - 1  14   19
STRSUB 1BGH - 1  25   35
STRSUB 1BGH - 1  43   48
STRSUB 1BGH - 1  59   63
STRSUB 1BGH - 1  68   70
STRSUB 1BGH - 1  76   78
STRSUB 1BGH - 1  83   85
REMARK ========================================================================
STRSUB 2PIA - 1   9   20
STRSUB 2PIA - 1  23   29
STRSUB 2PIA - 1  44   48
STRSUB 2PIA - 1  54   58
STRSUB 2PIA - 1  68   74
STRSUB 2PIA - 1  95   98
REMARK ========================================================================
STRSUB 1EFT - 1 315  322
STRSUB 1EFT - 1 341  344
STRSUB 1EFT - 1 347  354
STRSUB 1EFT - 1 367  374
STRSUB 1EFT - 1 385  390
STRSUB 1EFT - 1 393  403
REMARK ========================================================================
STRSUB 1BCO - 1 490  491
STRSUB 1BCO - 1 495  496
STRSUB 1BCO - 1 502  507
STRSUB 1BCO - 1 514  519
STRSUB 1BCO - 1 530  535
STRSUB 1BCO - 1 543  547
STRSUB 1BCO - 1 553  559
REMARK ========================================================================
STRSUB 1HEF E 1  10   15
STRSUB 1HEF E 1  18   24
STRSUB 1HEF E 1  32   34
STRSUB 1HEF E 1  43   48
STRSUB 1HEF E 1  53   66
STRSUB 1HEF E 1  69   78
STRSUB 1HEF E 1  84   85
REMARK ========================================================================
STRSUB 1PLS - 1   7   14
STRSUB 1PLS - 1  22   29
STRSUB 1PLS - 1  32   36
STRSUB 1PLS - 1  46   49
STRSUB 1PLS - 1  55   56
STRSUB 1PLS - 1  68   73
STRSUB 1PLS - 1  77   82
REMARK ========================================================================

