

PFRMAT FRV1
REMARK ========================================================================
REMARK Threading results for target T0014, compared against a dataset of
REMARK Hidden Markov Models of structures. At present the dataset consists
REMARK of about 15 models. The test set consists of a non redundant set of
REMARK predicted secondary structure sequences. The secondary structure
REMARK prediction of the target sequence is included in the test set. A
REMARK score is assigned by the structural models to the sequences in the
REMARK test set. The scores are based on loglikelihood ratios. By ranking
REMARK the scores assigned by the models in ascending order (the lowest
REMARK negative score values get the highest ranks) a decision is taken
REMARK about the most probable fold for the target sequence.
REMARK
REMARK This target protein (3dhq) is predicted to have a TIM barrel topology.  
REMARK Provided are the alignments of this query sequence against a triose-P 
REMARK isomerase:5timA (any triose isomerase would do) and against narbonin: 
REMARK 1nar .  
REMARK ========================================================================
AUTHOR 2225-3577-7739 Valentina Di Francesco, in Peter Munson's Analytical
AUTHOR 2225-3577-7739 Biostatistics Section at NIH, Bethesda, MD
REMARK ========================================================================
SEQRES T0014 MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVD
SEQRES T0014 HFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTL
SEQRES T0014 NRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPS
SEQRES T0014 AEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPV
SEQRES T0014 ITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
REMARK ========================================================================
TSCORE T0014 0 0.6 5TIM A 0
TSCORE T0014 0 0.4 1NAR x 0
REMARK ========================================================================
TALIGN T0014 0    11  48              5TIM A  0   2  39     0.7  1
TALIGN T0014 0    62 102              5TIM A  0  45  85     0.7  1 
TALIGN T0014 0   108 117              5TIM A  0  86  95     0.7  1
TALIGN T0014 0   118 133              5TIM A  0 102 117     0.7  1 
TALIGN T0014 0   134 144              5TIM A  0 120 130     0.7  1
TALIGN T0014 0   147 166              5TIM A  0 136 155     0.7  1
TALIGN T0014 0   167 173              5TIM A  0 159 165     0.7  1
TALIGN T0014 0   174 198              5TIM A  0 175 199     0.7  1
TALIGN T0014 0   199 208              5TIM A  0 206 215     0.7  1
TALIGN T0014 0   218 252              5TIM A  0 216 250     0.7  1
TALIGN T0014 0    13  28              5TIM A  0   2  17     0.3  2
TALIGN T0014 0    37  52              5TIM A  0  18  33     0.3  2
TALIGN T0014 0    61  89              5TIM A  0  45  73     0.3  2
TALIGN T0014 0    95 102              5TIM A  0  78  85     0.3  2
TALIGN T0014 0   108 115              5TIM A  0  86  93     0.3  2
TALIGN T0014 0   119 133              5TIM A  0 102 116     0.3  2
TALIGN T0014 0   134 144              5TIM A  0 120 130     0.3  2
TALIGN T0014 0   145 166              5TIM A  0 134 155     0.3  2
TALIGN T0014 0   167 174              5TIM A  0 159 166     0.3  2
TALIGN T0014 0   175 200              5TIM A  0 174 199     0.3  2
TALIGN T0014 0   213 218              5TIM A  0 200 205     0.3  2
TALIGN T0014 0   219 243              5TIM A  0 213 237     0.3  2
TALIGN T0014 0   244 252              5TIM A  0 242 250     0.3  2
TALIGN T0014 0     1  48              1NAR x  0  35  82     1.0  1
TALIGN T0014 0    49  68              1NAR x  0  96 115     1.0  1
TALIGN T0014 0    73 118              1NAR x  0 122 167     1.0  1
TALIGN T0014 0   119 147              1NAR x  0 169 197     1.0  1
TALIGN T0014 0   148 177              1NAR x  0 199 228     1.0  1
TALIGN T0014 0   184 207              1NAR x  0 239 262     1.0  1
TALIGN T0014 0   214 221              1NAR x  0 270 277     1.0  1
TALIGN T0014 0   240 251              1NAR x  0 278 289     1.0  1
REMARK ========================================================================


_______________________________________________________________________
Valentina Di Francesco                     Tel.  : (301) 402 0505
NIH/DCRT/Lab. of Structural Biology        Fax   : (301) 496 2172
12 South Drive MSC 5626                    email : valedf@helix.nih.gov
Bldg 12A - Room 2039
Bethesda, MD 20892 - 5626


