



PFRMAT FRV1
REMARK ========================================================================
REMARK Threading results for target T0020, compared against a dataset of
REMARK Hidden Markov Models of structures. At present the dataset consists
REMARK of about 15 models. The test set consists of a non redundant set of
REMARK predicted secondary structure sequences. The secondary structure
REMARK prediction of the target sequence is included in the test set. A
REMARK score is assigned by the structural models to the sequences in the
REMARK test set. The scores are based on loglikelihood ratios. By ranking
REMARK the scores assigned by the models in ascending order (the lowest
REMARK negative score values get the highest ranks) a decision is taken
REMARK about the most probable fold for the target sequence.
REMARK
REMARK This target protein (fcht) is predicted to have a tim barrel  
REMARK topology, with structure similar to the structure of Triose-P isomerase 
REMARK proteins (with probability 0.6) or of Xylose isomerase proteins (with 
REMARK probability 0.4).  We use the CATH classification
REMARK to interprete the word 'topology'. 
REMARK  
REMARK Provided are two alignments of this query sequence against 1ypi, chain A, 
REMARK having the Triose-P isomerase fold, and one alignment against 1dxi,  
REMARK chain A, having the Xylose isomerase fold. 
REMARK  
REMARK ========================================================================
AUTHOR 2225-3577-7739 Valentina Di Francesco, in Peter Munson's Analytical
AUTHOR 2225-3577-7739 Biostatistics Section at NIH, Bethesda, MD
REMARK ========================================================================
SEQRES T0020 MSRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAI
SEQRES T0020 GGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEM
SEQRES T0020 HKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDE
SEQRES T0020 PKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQL
SEQRES T0020 HESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQA
SEQRES T0020 FVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDAL
SEQRES T0020 ATVVLKKLGR 
REMARK ========================================================================
TSCORE T0020 0 0.60  1YPI A 0
TSCORE T0020 0 0.40  1DXI A 0
REMARK ========================================================================
TALIGN T0020 0     4  34              1YPI A  0   2  32     0.6  1 
TALIGN T0020 0    43  53              1YPI A  0  33  43     0.6  1
TALIGN T0020 0    64  89              1YPI A  0  44  69     0.6  1
TALIGN T0020 0    90 104              1YPI A  0  75  89     0.6  1
TALIGN T0020 0   109 215              1YPI A  0  90 196     0.6  1
TALIGN T0020 0   216 228              1YPI A  0 204 216     0.6  1
TALIGN T0020 0   236 267              1YPI A  0 217 248     0.6  1
TALIGN T0020 0     4  34              1YPI A  0   2  32     0.4  2
TALIGN T0020 0    43  53              1YPI A  0  33  43     0.4  2 
TALIGN T0020 0    64  83              1YPI A  0  44  63     0.4  2
TALIGN T0020 0    90 104              1YPI A  0  75  89     0.4  2
TALIGN T0020 0   110 115              1YPI A  0  90  95     0.4  2
TALIGN T0020 0   121 154              1YPI A  0 101 134     0.4  2
TALIGN T0020 0   155 186              1YPI A  0 140 171     0.4  2
TALIGN T0020 0   191 215              1YPI A  0 172 196     0.4  2
TALIGN T0020 0   216 228              1YPI A  0 204 216     0.4  2
TALIGN T0020 0   236 267              1YPI A  0 217 248     0.4  2
TALIGN T0020 0     1  12              1DXI A  0   1  12     1.0  1
TALIGN T0020 0    30  46              1DXI A  0  30  46     1.0  1
TALIGN T0020 0    47  74              1DXI A  0  57  84     1.0  1
TALIGN T0020 0    75 101              1DXI A  0 102 128     1.0  1
TALIGN T0020 0   112 125              1DXI A  0 143 156     1.0  1
TALIGN T0020 0   126 136              1DXI A  0 158 168     1.0  1
TALIGN T0020 0   137 172              1DXI A  0 176 211     1.0  1
TALIGN T0020 0   186 208              1DXI A  0 216 238     1.0  1
TALIGN T0020 0   210 234              1DXI A  0 239 263     1.0  1
TALIGN T0020 0   235 259              1DXI A  0 267 291     1.0  1
TALIGN T0020 0   260 286              1DXI A  0 322 348     1.0  1
REMARK ========================================================================


_______________________________________________________________________
Valentina Di Francesco                     Tel.  : (301) 402 0505
NIH/DCRT/Lab. of Structural Biology        Fax   : (301) 496 2172
12 South Drive MSC 5626                    email : valedf@helix.nih.gov
Bldg 12A - Room 2039
Bethesda, MD 20892 - 5626



