


PFRMAT FRV1
REMARK ========================================================================
REMARK Threading results for target T0031, compared against a dataset of
REMARK Hidden Markov Models of structures. At present the dataset consists
REMARK of about 15 models. The test set consists of a non redundant set of
REMARK predicted secondary structure sequences. The secondary structure
REMARK prediction of the target sequence is included in the test set. A
REMARK score is assigned by the structural models to the sequences in the
REMARK test set. The scores are based on loglikelihood ratios. By ranking
REMARK the scores assigned by the models in ascending order (the lowest
REMARK negative score values get the highest ranks) a decision is taken
REMARK about the most probable fold for the target sequence.
REMARK
REMARK This target protein (exta) is predicted to have the topology of serine  
REMARK proteases, with structure similar to the structure of native elastase 
REMARK (PDB: 3est) with probability 0.6, or of alpha chimotripsin (PDB: 4cha, 
REMARK chain A), with probability 0.4.  We use the CATH classification
REMARK to interprete the word 'topology'. 
REMARK  
REMARK Provided are the alignments of this query sequence against 3est and 
REMARK 4cha, chain A
REMARK ========================================================================
AUTHOR 2225-3577-7739 Valentina Di Francesco, in Peter Munson's Analytical
AUTHOR 2225-3577-7739 Biostatistics Section at NIH, Bethesda, MD
REMARK ========================================================================
SEQRES T0031 EVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVF
SEQRES T0031 VKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTET
SEQRES T0031 PYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDL
SEQRES T0031 KDGDKLELIGYPFDHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIF
SEQRES T0031 NSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
REMARK ========================================================================
TSCORE T0031 0 0.60  3EST x 0
TSCORE T0031 0 0.40  4CHA A 0
REMARK ========================================================================
TALIGN T0031 0    16  30              3EST x  0  16   30     1.0  1 
TALIGN T0031 0    46  58              3EST x  0  31   40     1.0  1
TALIGN T0031 0    59  69              3EST x  0  44   54     1.0  1
TALIGN T0031 0    74  82              3EST x  0  55   63     1.0  1
TALIGN T0031 0    83 109              3EST x  0  65A  91     1.0  1
TALIGN T0031 0   110 146              3EST x  0  94  128     1.0  1
TALIGN T0031 0   149 183              3EST x  0 129  164     1.0  1           
TALIGN T0031 0   184 211              3EST x  0 177  203     1.0  1
TALIGN T0031 0   220 230              3EST x  0 204  214     1.0  1
TALIGN T0031 0   231 240              3EST x  0 217  224     1.0  1
TALIGN T0031 0     1  11              4CHA A  0   1  11      1.0  1
TALIGN T0031 0    16  29              4CHA A  0  16  29      1.0  1
TALIGN T0031 0    47  54              4CHA A  0  30  37      1.0  1
TALIGN T0031 0    55  70              4CHA A  0  40  55      1.0  1
TALIGN T0031 0    74 145              4CHA A  0  56 127      1.0  1
TALIGN T0031 0   148 162              4CHA A  0 128 142      1.0  1
TALIGN T0031 0   165 183              4CHA A  0 143 163      1.0  1
TALIGN T0031 0   184 209              4CHA A  0 178 203      1.0  1
TALIGN T0031 0   220 240              4CHA A  0 204 224      1.0  1
REMARK ========================================================================


_______________________________________________________________________
Valentina Di Francesco                     Tel.  : (301) 402 0505
NIH/DCRT/Lab. of Structural Biology        Fax   : (301) 496 2172
12 South Drive MSC 5626                    email : valedf@helix.nih.gov
Bldg 12A - Room 2039
Bethesda, MD 20892 - 5626



