




PFRMAT FRV1
REMARK ========================================================================
REMARK Threading results for target T0032, compared against a dataset of
REMARK Hidden Markov Models of protein topologies. 
REMARK At present the dataset consists
REMARK of about 15 models. The test set consists of a  set of
REMARK predicted secondary structure sequences. The secondary structure
REMARK prediction of the target sequence is included in the test set. A
REMARK score is assigned by the structural models to the sequences in the
REMARK test set. The scores are based on loglikelihood ratios. By ranking
REMARK the scores assigned by the models in ascending order (the lowest
REMARK negative score values get the highest ranks) a decision is taken
REMARK about the most probable fold for the target sequence.
REMARK
REMARK This target protein (bc) is predicted to have the structural topology 
REMARK having a core that resembles the one of Phospholipase A2 proteins. 
REMARK The word 'topology' has to be interpreted in the sense used by the 
REMARK authors of the hierarchical classification of proteins CATH. The core 
REMARK consists of a N-terminal helix facing a short beta sheet, and other two 
REAMRK antiparallel helices. 
REMARK  
REMARK Provided is the alignment of this query sequence against 5p2p, chain A, 
REMARK which is one of the phospholipase proteins. 
REMARK ========================================================================
AUTHOR 2225-3577-7739 Valentina Di Francesco, in Peter Munson's Analytical
AUTHOR 2225-3577-7739 Biostatistics Section at NIH, Bethesda, MD
REMARK ========================================================================
SEQRES T0032 TACTATQQTAAYKTLVSILSDASFNQCSTDSGYSMLTAKALPTTAQYKLM
SEQRES T0032 CASTACNTMIKKIVTLNPPNCDLTVPTSGLVLNVYSYANGFSNKCSSL
REMARK ========================================================================
TSCORE T0032 0 1.0 5P2P A 0
REMARK ========================================================================
TALIGN T0032 0    12  20                       5P2P A 0   6  14   1.0   1
TALIGN T0032 0    27  43                       5P2P A 0  16  32   1.0   1
TALIGN T0032 0    50  65                       5P2P A 0  40  55   1.0   1
TALIGN T0032 0    69  74                       5P2P A 0  73  78   1.0   1
TALIGN T0032 0    78  85                       5P2P A 0  79  86   1.0   1
TALIGN T0032 0    86  98                       5P2P A 0  90 102   1.0   1
REMARK ========================================================================


_______________________________________________________________________
Valentina Di Francesco                     Tel.  : (301) 402 0505
NIH/DCRT/Lab. of Structural Biology        Fax   : (301) 496 2172
12 South Drive MSC 5626                    email : valedf@helix.nih.gov
Bldg 12A - Room 2039
Bethesda, MD 20892 - 5626





