8. |
S0980s2 |
Assisted
|
-
|
A1
|
2018-06-22 |
2018-06-25 |
- |
2018-07-08 |
This is a SAXS-assisted target representing the second subunit of the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
27. |
A0953s1 |
Assisted
|
-
|
A1
|
2018-07-02 |
2018-07-05 |
- |
2018-07-23 |
|
32. |
S0953s1 |
Assisted
|
-
|
A1
|
2018-05-29 |
2018-06-01 |
- |
2018-06-12 |
This is a SAXS-assisted target representing the first subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
38. |
X0953s1 |
Assisted
|
-
|
A1
|
2018-06-12 |
2018-06-15 |
- |
2018-07-01 |
This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094 and use the following credentials to login: Username: reviewer70721@ebi.ac.uk Password: M9rdkSXT Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.
|
1. |
n1008 |
Assisted
|
-
|
A1
|
2018-09-18 |
2018-09-21 |
- |
2018-09-30 |
This is REAL NMR data -assisted target corresponding to T1008. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes experimental data for dihedrals, ambiguous distance restraints, and the sequence. With respect to earlier suggested target N1008 (starting from capital 'N'), now both backbone AND extensive sidechain resonance assignments were used to generate the Ambiguous Contact file, so the false positive rate is very low. There is also a README explaining the data. The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
2. |
N1008 |
Assisted
|
-
|
A1
|
2018-08-10 |
2018-08-13 |
- |
2018-09-10 |
This is REAL NMR data -assisted target corresponding to T1008. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes four files: 1. ambiguous restraints; 2. dihedral angle restraints; 3. sequence file; 4. a README describing the sample and the nature of the restraints. The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
5. |
N0980s1 |
Assisted
|
-
|
A1
|
2018-08-07 |
2018-08-10 |
- |
2018-08-22 |
This is an NMR-simulated data-assisted target representing the first subunit of H0980 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for each target includes tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
7. |
S0980s1 |
Assisted
|
-
|
A1
|
2018-06-22 |
2018-06-25 |
- |
2018-07-08 |
This is a SAXS-assisted target representing the first subunit of the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
13. |
N0968s2 |
Assisted
|
-
|
A1
|
2018-08-03 |
2018-08-06 |
- |
2018-08-19 |
This is an NMR-simulated data-assisted target representing the second subunit of H0968 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
16. |
S0968s2 |
Assisted
|
-
|
A1
|
2018-06-11 |
2018-06-14 |
- |
2018-06-25 |
This is a SAXS-assisted target representing the second subunit of the H0968 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
21. |
x0968s2 |
Assisted
|
-
|
A1
|
2018-07-16 |
2018-07-19 |
- |
2018-08-02 |
This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
22. |
X0968s2 |
Assisted
|
-
|
A1
|
2018-06-26 |
2018-06-29 |
- |
2018-07-15 |
This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003 and use the following credentials to login: Username: reviewer91348@ebi.ac.uk Password: q9fEUNmI Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
3. |
S0992 |
Assisted
|
-
|
A1
|
2018-07-06 |
2018-07-09 |
- |
2018-07-22 |
This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
12. |
N0968s1 |
Assisted
|
-
|
A1
|
2018-08-03 |
2018-08-06 |
- |
2018-08-19 |
This is an NMR-simulated data-assisted target representing the first subunit of H0968 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
15. |
S0968s1 |
Assisted
|
-
|
A1
|
2018-06-11 |
2018-06-14 |
- |
2018-06-25 |
This is a SAXS-assisted target representing the first subunit of the H0968 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
19. |
x0968s1 |
Assisted
|
-
|
A1
|
2018-07-16 |
2018-07-19 |
- |
2018-08-02 |
This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
20. |
X0968s1 |
Assisted
|
-
|
A1
|
2018-06-26 |
2018-06-29 |
- |
2018-07-15 |
This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003 and use the following credentials to login: Username: reviewer91348@ebi.ac.uk Password: q9fEUNmI Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
4. |
N0980 |
Assisted
|
-
|
A1B1
|
2018-08-10 |
2018-08-13 |
- |
2018-08-26 |
This is an NMR-simulated data-assisted target representing the heterodimer target H0980. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for each target includes tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
6. |
S0980 |
Assisted
|
-
|
A2B2
|
2018-06-22 |
2018-06-25 |
- |
2018-07-08 |
This is a SAXS-assisted target representing the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
30. |
N0957s1 |
Assisted
|
-
|
A1
|
2018-07-26 |
2018-07-29 |
- |
2018-08-17 |
This is an NMR-simulated data-assisted target representing the first subunit of the H0957 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts); _dihed.txt (NMR-derived ranges for phi and psi); _ECs.txt (Evolutionary constraints); _RDCs.txt (NMR-derived residual dipolar couplings); _seq.txt (protein/domain sequence). The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
35. |
S0957s1 |
Assisted
|
-
|
A1
|
2018-05-31 |
2018-06-03 |
- |
2018-06-14 |
This is a SAXS-assisted target representing the first subunit of the H0957 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
42. |
x0957s1 |
Assisted
|
-
|
A1
|
2018-07-05 |
2018-07-08 |
- |
2018-07-25 |
This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
43. |
X0957s1 |
Assisted
|
-
|
A1
|
2018-06-14 |
2018-06-17 |
- |
2018-07-02 |
This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003 and use the following credentials to login: Username: reviewer44414@ebi.ac.uk Password: wbhw7G4Q Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
36. |
S0957s2 |
Assisted
|
-
|
A1
|
2018-05-31 |
2018-06-03 |
- |
2018-06-14 |
This is a SAXS-assisted target representing the second subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
44. |
x0957s2 |
Assisted
|
-
|
A1
|
2018-07-05 |
2018-07-08 |
- |
2018-07-25 |
This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
45. |
X0957s2 |
Assisted
|
-
|
A1
|
2018-06-14 |
2018-06-17 |
- |
2018-07-02 |
This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/ To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003 and use the following credentials to login: Username: reviewer44414@ebi.ac.uk Password: wbhw7G4Q Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
10. |
S0949 |
Assisted
|
-
|
A1
|
2018-05-22 |
2018-05-25 |
- |
2018-06-10 |
This is a SAXS-assisted target. The data were collected on the full length protein. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
9. |
F0964 |
Assisted
|
-
|
A1
|
2018-08-10 |
2018-08-13 |
- |
2018-09-30 |
This is a FRET data-assisted modeling target. This data type is new in CASP. Results will not be competitively assessed in CASP13. Rather, with this target we are initiating a discussion and allowing for a learning experience with the development of future FRET-based modeling techniques in mind. We are providing ample time to model this target with the closing date of September 30 (pending approval from the structure's author). The molecule’s two domains seem open to homology modeling but the relative domain orientation is not known (we have the structure of only the second of the two domains starting with the residues VIVIGDE). The FRET data suggest that there may be a distribution of domain orientations, opening a challenge of dynamic modeling in CASP. This topic will be discussed at the CASP13 meeting. The description of the FRET data and an overview of the results for this particular target can be found at http://predictioncenter.org/casp13/doc/FRET_CASP13_AGSeidel.pdf . The detailed FRET data will be released progressively as they become available.
|
14. |
S0968 |
Assisted
|
-
|
A2B2
|
2018-06-11 |
2018-06-14 |
- |
2018-06-25 |
This is a SAXS-assisted target corresponding to H0968 complex. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
17. |
x0968 |
Assisted
|
-
|
A2B2
|
2018-07-16 |
2018-07-19 |
- |
2018-08-02 |
This is a cross-linking assisted modeling target. The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
18. |
X0968 |
Assisted
|
-
|
A2B2
|
2018-06-26 |
2018-06-29 |
- |
2018-07-15 |
This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003 and use the following credentials to login: Username: reviewer91348@ebi.ac.uk Password: q9fEUNmI Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
11. |
N0989 |
Assisted
|
-
|
A1
|
2018-07-31 |
2018-08-03 |
- |
2018-08-18 |
This is an NMR-simulated data-assisted target corresponding to regular target T0989. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts); _dihed.txt (NMR-derived ranges for phi and psi); _ECs.txt (Evolutionary constraints); _RDCs.txt (NMR-derived residual dipolar couplings); _seq.txt (protein/domain sequence). The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
28. |
A0953s2 |
Assisted
|
-
|
A1
|
2018-07-02 |
2018-07-05 |
- |
2018-07-23 |
|
29. |
N0953s2 |
Assisted
|
-
|
A1
|
2018-07-20 |
2018-07-23 |
- |
2018-08-16 canceled on 2018-08-02 |
This is an NMR-simulated data-assisted target representing the second subunit of the H0953 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Each zip includes five (tab-delimited) text files. E.g. T0953s2_ambiR.txt (NMR-derived ambiguous contacts) T0953s2_dihed.txt (NMR-derived ranges for phi and psi) T0953s2_ECs.txt (Evolutionary constraints) T0953s2_RDCs.txt (NMR-derived residual dipolar couplings) T0953s2_seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
|
33. |
S0953s2 |
Assisted
|
-
|
A1
|
2018-05-29 |
2018-06-01 |
- |
2018-06-12 |
This is a SAXS-assisted target representing the second subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
39. |
X0953s2 |
Assisted
|
-
|
A1
|
2018-06-12 |
2018-06-15 |
- |
2018-07-01 |
This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094 and use the following credentials to login: Username: reviewer70721@ebi.ac.uk Password: M9rdkSXT Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.
|
26. |
A0953 |
Assisted
|
-
|
A3B1
|
2018-07-02 |
2018-07-05 |
- |
2018-07-23 |
This is a SANS-assisted target for the H0953 heteromer. With this target we want to explore (in a non-competitive mode) the added value of small-angle neutron scattering data for structure prediction. The data were collected on the full heteromeric complex. They are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/A0953_SANS* The description of the data can be found at http://predictioncenter.org/casp13/doc/SANS-SG_AM_tutorial.pdf
|
31. |
S0953 |
Assisted
|
-
|
A3B1
|
2018-05-29 |
2018-06-01 |
- |
2018-06-12 |
This is a SAXS-assisted target. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
37. |
X0953 |
Assisted
|
-
|
A3B1
|
2018-06-12 |
2018-06-15 |
- |
2018-07-01 |
This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094 and use the following credentials to login: Username: reviewer70721@ebi.ac.uk Password: M9rdkSXT Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.
|
34. |
S0957 |
Assisted
|
-
|
A1B1
|
2018-05-31 |
2018-06-03 |
- |
2018-06-14 |
This is a SAXS-assisted target. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
40. |
x0957 |
Assisted
|
-
|
A1B1
|
2018-07-05 |
2018-07-08 |
- |
2018-07-25 |
This is a cross-linking assisted modeling target. The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
41. |
X0957 |
Assisted
|
-
|
A1B1
|
2018-06-14 |
2018-06-17 |
- |
2018-07-02 |
This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003 and use the following credentials to login: Username: reviewer44414@ebi.ac.uk Password: wbhw7G4Q Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
23. |
S0975 |
Assisted
|
-
|
A1
|
2018-06-25 |
2018-06-28 |
- |
2018-07-14 |
This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
24. |
x0975 |
Assisted
|
-
|
A1
|
2018-08-06 |
2018-08-09 |
- |
2018-08-20 |
This is a cross-linking assisted modeling target. The experimental data were acquired by J.Rappsilber's group and posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0975_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target, please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
25. |
X0975 |
Assisted
|
-
|
A1
|
2018-07-16 |
2018-07-19 |
- |
2018-08-06 |
This is a cross-linking assisted modeling target. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010385 and use the following credentials to login: Username: reviewer81343@ebi.ac.uk Password: zK0BY71P Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
46. |
N1005 |
Assisted
|
-
|
A1
|
2018-08-10 |
2018-08-13 |
- |
2018-08-25 |
This is simulated NMR data-assisted target corresponding to T1005. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
47. |
S0987 |
Assisted
|
-
|
A1
|
2018-07-05 |
2018-07-08 |
- |
2018-07-22 |
This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
48. |
x0987 |
Assisted
|
-
|
A1
|
2018-08-07 |
2018-08-10 |
- |
2018-08-22 |
This is a cross-linking assisted modeling target. The experimental data were acquired by J.Rappsilber's group and posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0987_Berlin.csv. Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'. The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%. To access raw XL-MS data for this target, please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d
|
49. |
X0987 |
Assisted
|
-
|
A1
|
2018-07-23 |
2018-07-26 |
- |
2018-08-07 |
This is a cross-linking assisted modeling target. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010410 and use the following credentials to login: Username: reviewer33138@ebi.ac.uk Password: 0bvme2ld Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
50. |
N0981-D1 |
Assisted
|
-
|
A1
|
2018-08-09 |
2018-08-12 |
- |
2018-08-23 |
This simulated NMR data-assisted target corresponds to domain 1 (res. 34-119) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
51. |
N0981-D2 |
Assisted
|
-
|
A1
|
2018-08-09 |
2018-08-12 |
- |
2018-08-23 |
This simulated NMR data-assisted target corresponds to domain 2 (res. 120-190, 394-402) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
52. |
N0981-D3 |
Assisted
|
-
|
A1
|
2018-08-09 |
2018-08-12 |
- |
2018-08-23 |
This simulated NMR data-assisted target corresponds to domain 3 (res. 191-393) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
53. |
N0981-D4 |
Assisted
|
-
|
A1
|
2018-08-09 |
2018-08-12 |
- |
2018-08-23 |
This simulated NMR data-assisted target corresponds to domain 4 (res. 403-513) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
54. |
N0981-D5 |
Assisted
|
-
|
A1
|
2018-08-09 |
2018-08-12 |
- |
2018-08-23 |
This simulated NMR data-assisted target corresponds to domain 5 (res. 514-640) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence) The guidelines on the NMR-assisted data can be found at: http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf and http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf
|
55. |
S0981 |
Assisted
|
-
|
A3
|
2018-06-26 |
2018-06-29 |
- |
2018-07-15 |
This is a SAXS-assisted target. Experimental results are generated on the expressed protein with a tag (not provided in the released CASP sequence). The residues not included in the CASP target are encompassed in brackets in the full sequence below: [MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGS] MAFNYTPLTETQKLKDMYPKVNDIGN FLKTEVNLSDVKQISQPDFNNILASIPDSGNYYVTNSKGAPSGEATAGFVRLDKRNVNYY KIYYSPYSSNKMYIKTYANGTVYDWISFKLDEGSLYNEGNTLNVKELTESTTQYATLVNP PKENLNTGWVNYKESKNGVSSLVEFNPVNSTSTFKMIRKLPVQEQKPNLLKDSLFVYPET SYSNIKTDNWDTPPFWGYSSNSGRSGVRFRGENTVQIDDGSDTYPSVVSNRFKMGKELSV GDTVTVSVYAKINDPALLKDNLVYFELAGYDTVDDTSKNPYTGGRREITASEITTEWKKY SFTFTIPENTIGASGVKVNYVSLLLRMNCSSSKGNGAVVYYALPKLEKSSKVTPFITHEN DVRKYDEIWSNWQEVISKDELKGHSPVDIEYNDYFKYQWWKSEVNEKSLKDLAMTVPQGY HTFYCQGSIAGTPKGRSIRGTIQVDYDKGDPYRANKFVKLLFTDTEGIPYTLYYGGYNQG WKPLKQSETSTLLWKGTLDFGSTEAVNLNDSLDNYDLIEVTYWTRSAGHFSTKRLDIKNT SNLLYIRDFNISNDSTGSSVDFFEGYCTFPTRTSVQPGMVKSITLDGSTNTTKVASWNEK ERIKVYNIMGINRG The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html.
|
56. |
X0981 |
Assisted
|
-
|
A3
|
2018-07-17 |
2018-07-20 |
- |
2018-08-07 |
This is a cross-linking assisted modeling target. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010384 and use the following credentials to login: Username: reviewer66164@ebi.ac.uk Password: S5U0kqOw Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
57. |
S0985 |
Assisted
|
-
|
A1
|
2018-06-29 |
2018-07-02 |
- |
2018-07-18 |
This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
58. |
X0985 |
Assisted
|
-
|
A1
|
2018-07-19 |
2018-07-22 |
- |
2018-08-08 |
This is a cross-linking assisted modeling target. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010483 and use the following credentials to login: Username: reviewer80816@ebi.ac.uk Password: 4Z1QRYaH Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf
|
59. |
S0999 * |
Assisted
|
-
|
A2
|
2018-07-13 |
2018-07-16 |
- |
2018-07-31 |
This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html
|
60. |
X0999 * |
Assisted
|
-
|
A2
|
2018-08-01 |
2018-08-04 |
- |
2018-08-20 |
This is a cross-linking assisted modeling target. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. Raw XL-MS data for this target are currently unavailable.
|