13th Community Wide Experiment on the
Critical Assessment of Techniques for Protein Structure Prediction
Target List csv
 
Targets expire on the specified date at noon (12:00) local time in California (GMT - 7 hours).

Green color - active target; Yellow color - target expires within 48 hours; Orange color - target expires within 24 hours; Red color - target has expired for server TS/RR predictions, but is still open for QA predictions. Refinement and data-assisted targets are highlighted with the light grey background.

* targets selected for CAPRI experiment
All targets Regular Heteromers Refinement Assisted structure prediction
All groups | Server only SAXS | X-link | NMR | SANS | FRET
#
Tar-id
Type
Res
Stoi-
chiom.
Entry
Date
Server
Expiration
QA
Expiration
Human
Expiration
Description
1. X0999 * Assisted - A2 2018-08-01 2018-08-04 - 2018-08-20 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Raw XL-MS data for this target are currently unavailable.  

2. X0987 Assisted - A1 2018-07-23 2018-07-26 - 2018-08-07 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010410
and use the following credentials to login:
Username: reviewer33138@ebi.ac.uk
Password: 0bvme2ld

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

3. x0987 Assisted - A1 2018-08-07 2018-08-10 - 2018-08-22 This is a cross-linking assisted modeling target. The experimental data were acquired by J.Rappsilber's group and posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0987_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target, please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

4. X0985 Assisted - A1 2018-07-19 2018-07-22 - 2018-08-08 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010483
and use the following credentials to login:
Username: reviewer80816@ebi.ac.uk
Password: 4Z1QRYaH

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

5. X0981 Assisted - A3 2018-07-17 2018-07-20 - 2018-08-07 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010384
and use the following credentials to login:
Username: reviewer66164@ebi.ac.uk
Password: S5U0kqOw

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

6. X0975 Assisted - A1 2018-07-16 2018-07-19 - 2018-08-06 This is a cross-linking assisted modeling target.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010385
and use the following credentials to login:
Username: reviewer81343@ebi.ac.uk
Password: zK0BY71P

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

7. x0975 Assisted - A1 2018-08-06 2018-08-09 - 2018-08-20 This is a cross-linking assisted modeling target. The experimental data were acquired by J.Rappsilber's group and posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0975_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target, please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

8. X0968s2 Assisted - A1 2018-06-26 2018-06-29 - 2018-07-15 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer91348@ebi.ac.uk
Password: q9fEUNmI

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

9. x0968s2 Assisted - A1 2018-07-16 2018-07-19 - 2018-08-02 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

10. X0968s1 Assisted - A1 2018-06-26 2018-06-29 - 2018-07-15 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer91348@ebi.ac.uk
Password: q9fEUNmI

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

11. x0968s1 Assisted - A1 2018-07-16 2018-07-19 - 2018-08-02 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

12. X0968 Assisted - A2B2 2018-06-26 2018-06-29 - 2018-07-15 This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer91348@ebi.ac.uk
Password: q9fEUNmI

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

13. x0968 Assisted - A2B2 2018-07-16 2018-07-19 - 2018-08-02 This is a cross-linking assisted modeling target. The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0968_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

14. X0957s2 Assisted - A1 2018-06-14 2018-06-17 - 2018-07-02 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer44414@ebi.ac.uk
Password: wbhw7G4Q

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

15. x0957s2 Assisted - A1 2018-07-05 2018-07-08 - 2018-07-25 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

16. X0957s1 Assisted - A1 2018-06-14 2018-06-17 - 2018-07-02 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer44414@ebi.ac.uk
Password: wbhw7G4Q

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

17. x0957s1 Assisted - A1 2018-07-05 2018-07-08 - 2018-07-25 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

18. X0957 Assisted - A1B1 2018-06-14 2018-06-17 - 2018-07-02 This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010003
and use the following credentials to login:
Username: reviewer44414@ebi.ac.uk
Password: wbhw7G4Q

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf  

19. x0957 Assisted - A1B1 2018-07-05 2018-07-08 - 2018-07-25 This is a cross-linking assisted modeling target. The data were acquired by J.Rappsilber's group on the whole heteromeric complex. The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/x0957_Berlin.csv.

Note that this target name starts from the lowercase 'x', while cross-linking targets from A. Leitner's group start from the capital 'X'.

The cross-linker is heterobifunctional and reacts on one side with the side chains of K, S, T, Y via the amide and hydroxyl group, respectively. On the other side the cross-linker reacts indiscriminately with any C-H and N-H bond, be it in the side chain or backbone of any amino acid. The reported distance limit (25 Angstroms) is the estimated upper limit between the CAs of corresponding residues. The last column provides an estimated confidence level for the contact to be correct. The confidence score is derived from a false discovery rate (FDR) estimation. For example at 0.95, we estimate that the likely incidence of mismatch is at 5%.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/ and use the following credentials to login: Project accession: PXD010884 Username: reviewer91980@ebi.ac.uk Password: Ow22Vk9d  

20. X0953s2 Assisted - A1 2018-06-12 2018-06-15 - 2018-07-01 This is a cross-linking assisted modeling target (subunit 2 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094
and use the following credentials to login:
Username: reviewer70721@ebi.ac.uk
Password: M9rdkSXT

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.  

21. X0953s1 Assisted - A1 2018-06-12 2018-06-15 - 2018-07-01 This is a cross-linking assisted modeling target (subunit 1 of the heterocomplex). The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094
and use the following credentials to login:
Username: reviewer70721@ebi.ac.uk
Password: M9rdkSXT

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.  

22. X0953 Assisted - A3B1 2018-06-12 2018-06-15 - 2018-07-01 This is a cross-linking assisted modeling target. The data were collected on the whole heteromeric complex.
The experimental data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

To access raw XL-MS data for this target (whole complex), please go to https://www.ebi.ac.uk/pride/archive/projects/PXD010094
and use the following credentials to login:
Username: reviewer70721@ebi.ac.uk
Password: M9rdkSXT

Additional description of the method can be found at http://predictioncenter.org/casp13/doc/CASP_Webinar_XLMS.pdf.  

23. S0999 * Assisted - A2 2018-07-13 2018-07-16 - 2018-07-31 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
24. S0992 Assisted - A1 2018-07-06 2018-07-09 - 2018-07-22 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
25. S0987 Assisted - A1 2018-07-05 2018-07-08 - 2018-07-22 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
26. S0985 Assisted - A1 2018-06-29 2018-07-02 - 2018-07-18 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
27. S0981 Assisted - A3 2018-06-26 2018-06-29 - 2018-07-15 This is a SAXS-assisted target. Experimental results are generated on the expressed protein with a tag (not provided in the released CASP sequence). The residues not included in the CASP target are encompassed in brackets in the full sequence below: [MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGS] MAFNYTPLTETQKLKDMYPKVNDIGN FLKTEVNLSDVKQISQPDFNNILASIPDSGNYYVTNSKGAPSGEATAGFVRLDKRNVNYY KIYYSPYSSNKMYIKTYANGTVYDWISFKLDEGSLYNEGNTLNVKELTESTTQYATLVNP PKENLNTGWVNYKESKNGVSSLVEFNPVNSTSTFKMIRKLPVQEQKPNLLKDSLFVYPET SYSNIKTDNWDTPPFWGYSSNSGRSGVRFRGENTVQIDDGSDTYPSVVSNRFKMGKELSV GDTVTVSVYAKINDPALLKDNLVYFELAGYDTVDDTSKNPYTGGRREITASEITTEWKKY SFTFTIPENTIGASGVKVNYVSLLLRMNCSSSKGNGAVVYYALPKLEKSSKVTPFITHEN DVRKYDEIWSNWQEVISKDELKGHSPVDIEYNDYFKYQWWKSEVNEKSLKDLAMTVPQGY HTFYCQGSIAGTPKGRSIRGTIQVDYDKGDPYRANKFVKLLFTDTEGIPYTLYYGGYNQG WKPLKQSETSTLLWKGTLDFGSTEAVNLNDSLDNYDLIEVTYWTRSAGHFSTKRLDIKNT SNLLYIRDFNISNDSTGSSVDFFEGYCTFPTRTSVQPGMVKSITLDGSTNTTKVASWNEK ERIKVYNIMGINRG The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html.  
28. S0980s2 Assisted - A1 2018-06-22 2018-06-25 - 2018-07-08 This is a SAXS-assisted target representing the second subunit of the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
29. S0980s1 Assisted - A1 2018-06-22 2018-06-25 - 2018-07-08 This is a SAXS-assisted target representing the first subunit of the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
30. S0980 Assisted - A2B2 2018-06-22 2018-06-25 - 2018-07-08 This is a SAXS-assisted target representing the H0980 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
31. S0975 Assisted - A1 2018-06-25 2018-06-28 - 2018-07-14 This is a SAXS-assisted target. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
32. S0968s2 Assisted - A1 2018-06-11 2018-06-14 - 2018-06-25 This is a SAXS-assisted target representing the second subunit of the H0968 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
33. S0968s1 Assisted - A1 2018-06-11 2018-06-14 - 2018-06-25 This is a SAXS-assisted target representing the first subunit of the H0968 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
34. S0968 Assisted - A2B2 2018-06-11 2018-06-14 - 2018-06-25 This is a SAXS-assisted target corresponding to H0968 complex. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
35. S0957s2 Assisted - A1 2018-05-31 2018-06-03 - 2018-06-14 This is a SAXS-assisted target representing the second subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
36. S0957s1 Assisted - A1 2018-05-31 2018-06-03 - 2018-06-14 This is a SAXS-assisted target representing the first subunit of the H0957 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
37. S0957 Assisted - A1B1 2018-05-31 2018-06-03 - 2018-06-14 This is a SAXS-assisted target. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
38. S0953s2 Assisted - A1 2018-05-29 2018-06-01 - 2018-06-12 This is a SAXS-assisted target representing the second subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
39. S0953s1 Assisted - A1 2018-05-29 2018-06-01 - 2018-06-12 This is a SAXS-assisted target representing the first subunit of the H0953 heteromer. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
40. S0953 Assisted - A3B1 2018-05-29 2018-06-01 - 2018-06-12 This is a SAXS-assisted target. The data were collected on the full heteromeric complex. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
41. S0949 Assisted - A1 2018-05-22 2018-05-25 - 2018-06-10 This is a SAXS-assisted target. The data were collected on the full length protein. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/. The description of the data can be found at http://predictioncenter.org/casp13/doc/SAXS_Package_Reference_Page1.html  
42. N1008 Assisted - A1 2018-08-10 2018-08-13 - 2018-09-10 This is REAL NMR data -assisted target corresponding to T1008. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes four files: 1. ambiguous restraints; 2. dihedral angle restraints; 3. sequence file; 4. a README describing the sample and the nature of the restraints.

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

43. n1008 Assisted - A1 2018-09-18 2018-09-21 - 2018-09-30 This is REAL NMR data -assisted target corresponding to T1008. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes experimental data for dihedrals, ambiguous distance restraints, and the sequence. With respect to earlier suggested target N1008 (starting from capital 'N'), now both backbone AND extensive sidechain resonance assignments were used to generate the Ambiguous Contact file, so the false positive rate is very low. There is also a README explaining the data.

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

44. N1005 Assisted - A1 2018-08-10 2018-08-13 - 2018-08-25 This is simulated NMR data-assisted target corresponding to T1005. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

45. N0989 Assisted - A1 2018-07-31 2018-08-03 - 2018-08-18 This is an NMR-simulated data-assisted target corresponding to regular target T0989. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts); _dihed.txt (NMR-derived ranges for phi and psi); _ECs.txt (Evolutionary constraints); _RDCs.txt (NMR-derived residual dipolar couplings); _seq.txt (protein/domain sequence).

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

46. N0981-D5 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 5 (res. 514-640) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

47. N0981-D4 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 4 (res. 403-513) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

48. N0981-D3 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 3 (res. 191-393) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

49. N0981-D2 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 2 (res. 120-190, 394-402) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

50. N0981-D1 Assisted - A1 2018-08-09 2018-08-12 - 2018-08-23 This simulated NMR data-assisted target corresponds to domain 1 (res. 34-119) of T0981. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for the target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

51. N0980s1 Assisted - A1 2018-08-07 2018-08-10 - 2018-08-22 This is an NMR-simulated data-assisted target representing the first subunit of H0980 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

52. N0980 Assisted - A1B1 2018-08-10 2018-08-13 - 2018-08-26 This is an NMR-simulated data-assisted target representing the heterodimer target H0980. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

53. N0968s2 Assisted - A1 2018-08-03 2018-08-06 - 2018-08-19 This is an NMR-simulated data-assisted target representing the second subunit of H0968 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

54. N0968s1 Assisted - A1 2018-08-03 2018-08-06 - 2018-08-19 This is an NMR-simulated data-assisted target representing the first subunit of H0968 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts) _dihed.txt (NMR-derived ranges for phi and psi) _ECs.txt (Evolutionary constraints) _RDCs.txt (NMR-derived residual dipolar couplings) _seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

55. N0957s1 Assisted - A1 2018-07-26 2018-07-29 - 2018-08-17 This is an NMR-simulated data-assisted target representing the first subunit of the H0957 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Zip file for each target includes five tab-delimited text files: _ambiR.txt (NMR-derived ambiguous contacts); _dihed.txt (NMR-derived ranges for phi and psi); _ECs.txt (Evolutionary constraints); _RDCs.txt (NMR-derived residual dipolar couplings); _seq.txt (protein/domain sequence).

The guidelines on the NMR-assisted data can be found at:
http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf
and
http://predictioncenter.org/casp13/doc/NMR_format_descr.pdf  

56. N0953s2 Assisted - A1 2018-07-20 2018-07-23 - 2018-08-16
canceled on
2018-08-02
This is an NMR-simulated data-assisted target representing the second subunit of the H0953 heteromer. The data are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/.

Each zip includes five (tab-delimited) text files. E.g. T0953s2_ambiR.txt (NMR-derived ambiguous contacts) T0953s2_dihed.txt (NMR-derived ranges for phi and psi) T0953s2_ECs.txt (Evolutionary constraints) T0953s2_RDCs.txt (NMR-derived residual dipolar couplings) T0953s2_seq.txt (protein/domain sequence)

The guidelines on the NMR-assisted data can be found at http://predictioncenter.org/casp13/doc/Montelione-CASP_NMR.pdf  

57. F0964 Assisted - A1 2018-08-10 2018-08-13 - 2018-09-30 This is a FRET data-assisted modeling target.
This data type is new in CASP. Results will not be competitively assessed in CASP13. Rather, with this target we are initiating a discussion and allowing for a learning experience with the development of future FRET-based modeling techniques in mind. We are providing ample time to model this target with the closing date of September 30 (pending approval from the structure's author).
The molecule’s two domains seem open to homology modeling but the relative domain orientation is not known (we have the structure of only the second of the two domains starting with the residues VIVIGDE). The FRET data suggest that there may be a distribution of domain orientations, opening a challenge of dynamic modeling in CASP. This topic will be discussed at the CASP13 meeting.

The description of the FRET data and an overview of the results for this particular target can be found at http://predictioncenter.org/casp13/doc/FRET_CASP13_AGSeidel.pdf .
The detailed FRET data will be released progressively as they become available.  

58. A0953s2 Assisted - A1 2018-07-02 2018-07-05 - 2018-07-23  
59. A0953s1 Assisted - A1 2018-07-02 2018-07-05 - 2018-07-23  
60. A0953 Assisted - A3B1 2018-07-02 2018-07-05 - 2018-07-23 This is a SANS-assisted target for the H0953 heteromer. With this target we want to explore (in a non-competitive mode) the added value of small-angle neutron scattering data for structure prediction.

The data were collected on the full heteromeric complex. They are posted at http://predictioncenter.org/download_area/CASP13/extra_experiments/A0953_SANS*

The description of the data can be found at http://predictioncenter.org/casp13/doc/SANS-SG_AM_tutorial.pdf  

Protein Structure Prediction Center
Sponsored by the US National Institute of General Medical Sciences (NIH/NIGMS)
Please address any questions or queries to:
© 2007-2018, University of California, Davis